SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000086215-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000086215-RA
Domain Number 1 Region: 10-49
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.000000536
Family Helical scaffold and wing domains of SecA 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000086215-RA
Sequence length 111
Comment protein AED:0.77 eAED:1.00 QI:0|0|0|0.5|1|1|2|0|111
Sequence
MRLEEGAKLLFENRKRLFEYGEILNSQHDHIYTECRRALEDDNIYDIISIIMSILKPIYC
DIILIPIKAYITILLNRDSYSCSTRSTTNARCTNLWMKCNIGALLTSWGDR
Download sequence
Identical sequences PITA_000086215-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]