SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000001839-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000001839-RA
Domain Number 1 Region: 505-624
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.59e-18
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000001839-RA
Sequence length 661
Comment protein AED:0.15 eAED:0.17 QI:0|0|0|1|0.81|0.83|12|0|661
Sequence
MTKSASGEGEFELVVHYHDQNNKVRVMAPPPRSTRRRLKEAVKETLFPDDPLREIRKESS
VARKVLMTLQYLFPVLQWAPQYSFHLFKSDVISGITIASLAIPQGISYAKLADLPPIIGL
YSSFVPPIIYVILGSSKDLAVGTAAVVSLFLASRIGSEVSPEENPHLYMGLVFTATFFAG
VFQASLGLLRLGFIIDFLSHATIVGFMAGAATIVCLQQLKVILGLRHFTTKTDVISVMSS
VFQQVDKWRWESIVMGICFLCFLLLSRYIVSASFLQHLRFRKAAEFGMHPSKKIPKLLLI
SAGAPLLSVALGSILVFCTRAENHGIQIEGIAVGRSFSMFKNYHIDGNKEMMAIGMMNIV
GSCTSCYITTGPFSRSAVNFNAGCKTAVSNLVMATSLMITLLFLTPLFHYTPMVVLAATI
VSAMLGIIDVKAAYHMWTVDKIDFVVCMAAFLGVVFDDFQLGLIIAVSISVARVMMHVIR
PRIAVLENICGTSIFRNKEQYPHSARISGILILSLSSPIYFSNCNYIRERVLRWIEEEEE
YYLANCSPDILHYIVLDMSGVSSIDTSGISMLEELKMTLQKRKLELAFANPGPEFMEKLH
KLKFGQLVDPKLLFLTVGEAINVCTSLLHEKNLNLTTNTRGVDDEEAEIDRQSIHDNQTN
V
Download sequence
Identical sequences PITA_000001839-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]