SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000002652-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000002652-RA
Domain Number 1 Region: 284-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-18
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 75-203
Classification Level Classification E-value
Superfamily POZ domain 1.57e-16
Family BTB/POZ domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000002652-RA
Sequence length 581
Comment protein AED:0.04 eAED:0.04 QI:492|1|1|1|1|1|4|912|581
Sequence
MIMAQVSLSQFSPSFNSSSNISNNSSYRSISSGGGELGACSADSSPVHPSKSPDIAALEK
LSESIESLLSIADLDCSDAEIVVQDRAVPVHRCILAARSPFFREKLFPSTRPESQAASAK
LRYELKDWLTEGNVGYEAFRILLAYLYSGKVKAPPTEVCICMDSTCVHDACRPAVDFTVE
LMYAAHVFQIPELVSLSQRRLLNFVERAQVEDVIPILIAANVCETGNDQLLTRCIHRVGR
SDLDNVALEKELPQEVVKRVKEFRSSLGVATFPSSSQQKNIQRIQRALDSDDVELVKLLL
QEGEGKITLDDAYALHYAAAYCDPKITSELLEIGCADVNLKNPRGYTVLHIAAMRREPGT
IVALLTKGAQPSELTFDERTALQIAKRLTRAIDCYRTTDEGKESPKDRLCIEILERAESR
NPLRAEAFSFAFGGEDMRTKLLDLENRVALAKILFPTEAKLAMEIAHVDATSEFTVDLNE
TPTAVMTKKFIARMKALSRTVELGKHFFPRCSAVLNKIMDDDLPEITLEEQRVKRKRYDE
LKTVVSEAFSKDKADIEKSGMSSSSSSSSVRDGLRHKSKYR
Download sequence
Identical sequences PITA_000002652-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]