SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000013968-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000013968-RA
Domain Number 1 Region: 249-349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000012
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1008-1065
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000275
Family GCC-box binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1798-1854
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000915
Family GCC-box binding domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1340-1397
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000144
Family GCC-box binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000013968-RA
Sequence length 2030
Comment protein AED:0.04 eAED:0.04 QI:0|0.5|0.33|0.55|0.75|0.77|9|0|2030
Sequence
MSSDPSHKSESLVTVFYGQSPSPETVTQIDLSLTIQADCPHTELVNVDWSEIIPLRLSTE
AVTVIGVLRSEPEILNIELANGRTQYNISFNDENGIPRNLIIDKDWTKDLASAQSGNWIR
PTPPRELYSVSERGGTIAHPLANNSWQAGDAVDVHYVNHWKPGRVIETSCTGEKVIYFYN
GSNNKVDSSLEIRAQVIWNGESWLLVDNETSQMGTKGSFKNRYKPHVGEGLLSPNREMVT
DFVKNIFTEYPSFARTIQRKCLGRSGKMSFPVMFMTKYLSGSQGIVTFDDCDGLSWRVEW
YAYLQSGRRLVFTTGWPEFASDHNAKDGDILLVEVLNSEHFRVQILSGESCIAVKENKDP
GCSREVASNINDILDARSKRFSSRETLQVFLKGGTLGNCIKAKRENRASAGYRRYRTWQE
NQSRKAKIGDKADMEVVRSKIGEYKHEVERETCSLTFDTIPKDKTTTVSQEQTGNHQPVS
FFATKEASSSILGLTTIQDDCSSCPNAQKTPLGPKLIVDRQLIDSGSQQSDSTLVFHKRG
LSGSEKEDSRINLSPCHYPLSSIFGFQHTFTGGRQYAASFCQSSKEICSQYVFCGFRFCM
LHILEDPSAPYKQCDFIVPSSGQRCEFAVSLSIADIRFCQIHKQMRMTESRLEDVKENSY
CGKMSLLVMAAMVAHHDLEFFDPSKMLEPIETNLTDHSGRQSSLPKILAHPQAATFDVPP
VNMQHRQADQVSGDDKQLTKYFPVRRKTGHQRSGIADKVQSKQKMPEAGNSHVQYDAKVS
VSRKTLKGVRGNCSNTGTSIMKRRDLHVPVAAGYVDSGIEHGGKSCAGILERNVFSNMNE
SEILEKGLCMKGIPFKKETFEGGKSCRNGTSSSPKKMLSEATCQVYEKPNRIPLNTPFFG
PGAKRRYSLFRSVPSLVEIGPIDLTRVGLMWTPAKLLQCNGKDSSAERLDQIRLTPIIDL
GELDITTMSLKCPVREPRRSTGILKKQKQRSDTKEVVRKGNGRRVSFSRFVGVRKRPWGA
YGAEIRTPEGKRLWLGTYTTEEAAAHAYDDAARKFKGKGAVTNFSKDSDIDSPLEASLRS
LKDQVNMFREAPKRRRSSNSKKRDEDQLLPDENAAKNLWDLTNPRRSPPRMLDGDSPSIC
GVNDTSNYINMDNTSPGGCGSSPAARVDNHEVGNQTLISHEFESTTAEDQHIQELCGENG
SKLTERFARVYSKKQKLRKTVDLNRSTLSVTLPEDILGEEETQDLFCCGSNEKKKFRCIS
TAVAEIPDKNNPPEYSADKDKQADCKLESRYYSVDLDVSAAELGEHFIDAISQAKRATDN
ENNFSSPEQNASPGNVENESHFFGVRKTSSGRFEASLYDRNKKKKVYVGMYDTMIEAARA
RDQRAIDLGAASVLNFPELQEKTNLQRETELLDSSSLKNLFNVQSAMQQLSVKGERHANV
TPQKEIKRKPRNFQKLPTAKRSKVIDHSPGNNDKINGLYDAKFTNFEEPGYAVLQSKPEV
KYANTGSPDSPTHSCLEIQKNGQGGLNTYTSRGRKKKKSVSEYVEMSHSEISKNHQGHKL
SESGDHTTYMPKQDFVYGFDGEQYIESDYSRVYRTTSKRRAMQSRSGRGHINPVHEEEKL
GIQSENFEETGGCNFLNDSNNLEDSNIIFFGENENGKDQSSHLNIHSVVSDYQNADKVDG
DISYSTVNTSQLRLSVETLGEKGPHNHHVQNTNPGIFPMMLPIAEPKKSRSARVYSSKNL
YQEGDCSWQETGQQAVLPIKTSEKCSTRSQPLGKAGRSRKFRHKAASKRSSFTRHVAYRG
VYSNGKKFQSIYYNPVSKKHTYLGTFCSGEDAAKAYDQVAYGQLGESAKMNFPPDCLEPM
ESQETKQKNSMHFQLEQMSDSQGKVAVGSGLNDAISSKQSQEDFEKETELLEVNEASSDC
YNDYSQQTKLDISCQPSTIETFRNKANVLDDNLVITLLAEHSDGKLHRPLRMMSFPLETE
IKGTYSASDHSKIGDRNELSGGTAFDALGEILKASEVLNIPQDTAPHVST
Download sequence
Identical sequences PITA_000013968-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]