SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000023205-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000023205-RA
Domain Number 1 Region: 195-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-21
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 2 Region: 510-612
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-21
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000863
Family B3 DNA binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000023205-RA
Sequence length 811
Comment protein AED:0.07 eAED:0.07 QI:117|1|1|1|0.5|0.4|5|0|811
Sequence
MEFQKGWEKFVCDHRLELGDFLVFKYIRKSYFTVQIFGRSGCEKRNVFNMKNFGASLLSL
EGKADAQDNCPDTLVKSFDADSYQGVPKRTDSQMPINLYTDEDSNEQAMGTSKFKQSVAE
ACPNSAKHPYHGITARTIKNTESYQPSFSDKKHEIVTSAEPGGKSYVQAYYVSCRRPVTQ
AERNKALKDARSFKSTKPLALIVMKPSHVYQGFWLALPKRLDSCFQLPKGRYQVTLLGPA
NKEWTVQYIGDCGRAGLSGGWKHFSVDNNLEEGDVCIFELVNKKKYIFRVYIFRVIKNYT
PYKRMEGTRVNENNGRGRKRIALPSLSLGENANCGVQNKCPDTPVDSSDADQNQIVAKCT
DSKLLISLDSDEELDDQAMVTCKLEQSVAGTSVNQANPGCRGLAACTVKNARKRCEIVTY
AENEGKKRKIVTSAENKEKKGEIVILADSKGKKYRIATYAENEGKKKNKIVTSAENEGKS
YLGAYFVSCRRAVTLAERKKAFNAANAFKSSNPFSLLIMKPSHVYQGFYLSFPKRFEACF
QLPQERMHLTLLGPTNKEWQVQYLGNNLRPGLSGGWRYFSLENNIEEGDVCVFELVNAIK
YCFKVHIFRVVKKCTPFKKMEGTKINDKDGQCMKIIADPVNHFKKRKVSRMSTKKIGTIS
AVQASRSHIPDILEQGIVPKKEEKQVQNKRDHSGSPNKFVEMAKSSWDSRKDRRTSPRFN
KVYNSSEHPKKQFSRPAFANRKQTIDTDTMLLSAKTNTLLDDTNGEADLIIIWDSNDVAG
PSNIIPSQESIHERPVLTKSKVQVVKQENQK
Download sequence
Identical sequences PITA_000023205-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]