SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000029231-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000029231-RA
Domain Number 1 Region: 160-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-25
Family B3 DNA binding domain 0.03
Further Details:      
 
Domain Number 2 Region: 632-711
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000638
Family PB1 domain 0.026
Further Details:      
 
Weak hits

Sequence:  PITA_000029231-RA
Domain Number - Region: 342-395
Classification Level Classification E-value
Superfamily Fungal elicitin 0.0994
Family Fungal elicitin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000029231-RA
Sequence length 765
Comment protein AED:0.32 eAED:0.32 QI:130|0.8|0.90|1|0.6|0.81|11|598|765
Sequence
MAYADSFRNFSGRLPHNSPAGNYSTLANEVPGAPQSLMPSQSTNSTQNSFSGGIGTDASE
SLLYEELWHACAGPLVTMPRVGERAFYFPQGHIEQVEASTNQGVDQHMPLYNLPFKILCR
VINVQFRAEPETDEVFAQITLLPEGDQNESSHDSGAAPPQPRKSNVHSFCKTLTASDTST
HGGFSVLRRHADECLPPLDMSQQPPSQELVARDLHGMEWRFRHIFREFIIPYDKYMEAVQ
WDETSVVPRPERVSPWEIETFVASSAALNPLPAPRTKKPRPNLVSSSQELMIHGSGKTAT
DSSQVHRLPRVLQGQEMRTFGGSLGDSEVESSQKPLMWGSSVDQKQDSVGSRGRLASEYW
VSQCRQDTVYSDSYSVIQGARDTQQLCGPTACQNMEIFQRLKPPPKQFQDEENGIIDRSG
TKLQLSSSWSVMPSDNPHELTESDLKLSVTSNPSHKQAGLGKWSGLDPPPLLSDVGSKES
QGNWFVSLISQPQVDFSGTHAPGQLERNPARSHGTSNLGMAVQQSTLQSREMLEEKGVLS
GARSADCKLFGFHLIENSVGELTPSTIRGLAAGEDIHVSVPNITVHEAQSESDPHFEPSS
MAKMDMPAAITDEEKSSQKSSKETHSRPQTNSTRSCTKVHKQGSALGRAVDLTKFEGYTE
LIRELEQMFNIEGELEDPSKGWQVVYTDNEGDMMLVGDDPWQEFCSIVRKIYIYTREEVE
KMTPQTPSAKLKGCSEEPVTRETSRSSDRQDSSIAGVTAERSSDA
Download sequence
Identical sequences PITA_000029231-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]