SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000033801-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000033801-RA
Domain Number 1 Region: 353-446
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.62e-29
Family B3 DNA binding domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 207-261
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000216
Family GCC-box binding domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000033801-RA
Sequence length 658
Comment protein AED:0.05 eAED:0.05 QI:0|0|0|0.66|1|1|3|0|658
Sequence
MEYEYEVVDVTVCETSEGPPNGLRGKRSASTTTLWQSEIDSANEALSLACCVTNVEMSFT
VYSEKDASASTPANHDLGRQDWCARDKAQEQTTNEGMKGWGSAEDRQDDDVESAMTEELN
PSAMGISENGWQPKQDAVMLKASGSPRSMEKNFRGQQRMGSEMSVVSGSGGESDVFEDPR
RYSMSMEQTGKLPSSHYKGVVPQPNGRWGVVPQPNGRWGSQIYEKHQRVWLGTFDEEEDA
AKAYDRAALKFRGRDAITNFSPARDGDSEARFMREHSMGEIVDMLRKHTYDAEFEHHRKS
LMLREALSASENKAGASGLKVSGVCQENQETVYANTNVSSSAAVAAKDMEDPPREHLFDK
ALTPSDVGKLNRLVIPKQYAEKYFPLDANSSEKGLLLNFEDDTGKVWQFRYSYWNSSQSY
VLTKGWSRFVKDKRLETGDIVSFHKGFAQTDHFYISWSRRPSGQPGLGFDPHYQKSKAEV
VYPVKRPSFLNLFNSRGIDNAARWMPVFWPSSSNPNSITQFSSHSFSSPIRKIGHIDALG
SQCSATPFNSAIPFYFSASPTNQTVQSRFHAINSDASQPMDLKKSLNSGDGRPNIAPLHP
FVEPSEPSTAQGLVTPEYKVVSGLDPATKKGVRLFGVTLAEPQRFSVQHHEQLNLFPR
Download sequence
Identical sequences PITA_000033801-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]