SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000038323-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000038323-RA
Domain Number 1 Region: 133-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-28
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000038323-RA
Sequence length 789
Comment protein AED:0.01 eAED:0.01 QI:0|1|0.66|1|1|0.66|3|323|789
Sequence
MPVPCTMNGPRITSMDSAHGYGLVMQRGADDGNPGLDSQLWHACAGGMVQMPSVNARVYY
FPQGQAEHSATNVEFSANLRVKPAILCRVLNVKFMADTETDEVYSRIRLVPIKPNEAAME
DCSEDNDNAAANEKPVSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYTSDPPVQTVLA
KDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRSLNGELCVGIRRST
RSTGGGDSSAWHLAGQQQQHGSCMSPYRSSSRWEVKGGDNFSAAFFGGGDKSSANGNSNG
FARNKGKVSAKSVIESVTLAANGQPFEVVYYPRASTPEFCVKANAVDAALRMKWTAGMRF
KMAFETEDSSRISWFMGTISLVQCADPIHWPTSPWRLLQVTWDEPDLLQNVKRVSPWLVE
VVSNVPPIQLSPFTLPKKKLRVSQHPEFQFEGHGIMGGLQMATLTNNVLGQINPWHGLSE
NVPAGMQGARHGHIYGVPLSDFHSNKLQSGLSLDSFHQLEQGALSSTPVSTDLNIGCFSQ
LERSSVQDNLSCVLTMGNSSQSEQKATKGRSTSSTTKSAPFLLFGKPIHTEQSPKSEQQQ
QSGVSSSDGPGFHVVNDSGSPGLTSNSSTDGNPEVVDRLQRAMAGRSDTSKLSENYGLRL
YCGETLDSSVNNGGGNLSWFKDRQVSLQTLENGSGGKTSEDGVVHCKAFLESEDVGRTLD
LSLFSSYEELHNKLAKMFGIEDSDLSNRVLYKDAAGVGRHTGEQPYGDFMKTVRRLTILS
DSSSDNMGR
Download sequence
Identical sequences PITA_000038323-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]