SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000055256-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000055256-RA
Domain Number 1 Region: 253-349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.79e-17
Family B3 DNA binding domain 0.0095
Further Details:      
 
Domain Number 2 Region: 36-84
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000049
Family B3 DNA binding domain 0.0073
Further Details:      
 
Weak hits

Sequence:  PITA_000055256-RA
Domain Number - Region: 83-151
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0722
Family Pectate lyase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000055256-RA
Sequence length 350
Comment protein AED:0.16 eAED:0.16 QI:0|0.33|0.5|0.75|0|0.25|4|0|350
Sequence
MVLLLRCLQTGLNEVRLRVSQLQFWKAHVVTYGRQRCIFSDKLTFFTEGWEKFVSDHWIQ
LEDIVVFRHVDDAHFLVQIFDVSGYEKKNTVTVKNCESHNLNKLGIYGTGAATFRQTVKG
NPFKDASGDVNNVPRRITRSIGLKVAITGNCAEACISNGRRLSTVKQEFPAHSKINVKQE
LGLPKSNWNFSENKVGSSAKDPIILDSEEEFDCQASSSYSHDEDSYEVSYHFSSEVLQGK
VHPEDKTANSVKKGKPKFTRVMKKSAVTHSFWLSIPQRFGRCWFPRGNVEVLLLHQKREW
RAVFVGERNTCGLGPGWKFFAVDNELMIGDICTFELEDKDNYILKVHIQR
Download sequence
Identical sequences PITA_000055256-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]