SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000058247-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000058247-RA
Domain Number 1 Region: 303-405
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-28
Family B3 DNA binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 161-217
Classification Level Classification E-value
Superfamily DNA-binding domain 1.31e-17
Family GCC-box binding domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000536
Family Calcium ATPase, transmembrane domain M 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000058247-RA
Sequence length 596
Comment protein AED:0.07 eAED:0.07 QI:0|0|0|0.5|1|1|2|0|596
Sequence
MEDAYARSIAEVLEAFRTEPAKGLTDSQVVEHARIYGRNAMGKKKIFVNKKNSATFCSVY
KDSPLTFSDPFEFLNDGSALREQITPSVTGFSGNGRRLELEESQFKDWALARSKGKNVRE
LERLGSGVNVVPESVGESDGFEDLRRYSLLSLQQASKLQSSQYKGVVPQPNGRWGAQIYE
KHERVWLGTFNKEEDAAMAYDRAALKFRGWDAMTNFSPARGGNQEARFMGEHTKEQIVDM
LRKHSYDEEFEHHSKRIMMTAAWPTCTNNEEQKSEAPGQRWTGTRWPDDGNGNSATAGLL
REHLFDKAVTPSDVGKLNRLVIPKLHAEKYFPLVINSSEKGSLLNFEDNMGKVWRFRYSY
WKSSQSYVLTKGWSRFVKDKKLEVGDFVSFHRGSSEPHQLYISWRHRASVRPHLGVGPQS
KAEFVHPMKGSLSSNSFNSGTQTTVVGNAQWLPFVWPSSSNSEAFTQFNSNYMPPLVKKV
GNFDHLWCHIPATPLNGEFSFCFSEPPAKQANQGSFHNSVNSGEGSTNIKPDQGSFHNSL
NSGEGSTNIKPLHPFVNPSQLSAAQELETPEHKATWSLDPATKKGVRLFGVSLTES
Download sequence
Identical sequences PITA_000058247-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]