SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000065197-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000065197-RA
Domain Number 1 Region: 263-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-70
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 91-204
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-29
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000065197-RA
Sequence length 492
Comment protein AED:0.09 eAED:0.11 QI:0|0|0|0.5|1|1|2|0|492
Sequence
MRWEVYYYPQGHAEHAATVPDFVGNLRMSPSILCRVVSVKFLADTETDKVYARMRLVPIS
DGEQNSSVEDSEAESRPPSRAVNSQTESTNNNHPPASFAKTLTQSDANNGGGFSVPRYCA
ETIFPRLDYSSDPPVQTILAKDVHGEVWKFRHIYRGTPRRHLLTTEWSTFVNQKKLIAGD
TIVFLRSVTGELCVSVRRSTRSTTECHSHSNSHSHGVLAVLIVVKFKKRNGPLEDSTASS
SFKALTRSLMGRGKRPETVARESLPTEGLYIFTTRELQRATDNFSECHLLGMGGSGKVYL
GKLPSGKQGAIKRIVQKRKLDQFYQEVELLSRLRHPNLTSLLGYCRHRGEYMLVYEYMPG
GDLECLLYRQQNPVLPWERRLGVALDCAEGLAYLHLFPGGAIVHRDIKPTNILLNGSGQA
KLLDFGISKLIAPDFSHASTKIKGTTGYLDPEYFTHGKLTEASDVYSFGIVLLQLIFGQK
ARYGVDMMQFFI
Download sequence
Identical sequences PITA_000065197-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]