SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003960 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003960
Domain Number 1 Region: 41-165
Classification Level Classification E-value
Superfamily dUTPase-like 2.62e-18
Family dUTPase-like 0.0017
Further Details:      
 
Domain Number 2 Region: 162-221
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000026
Family Retroviral protease (retropepsin) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003960   Gene: ENSFALG00000003801   Transcript: ENSFALT00000003978
Sequence length 225
Comment pep:novel scaffold:FicAlb_1.4:JH603807.1:17818:19340:1 gene:ENSFALG00000003801 transcript:ENSFALT00000003978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRQTESQFGFKSEPVKQMLDYLFDTQVLLPNDLQGISRLMFTLQPATAGSLSLDLAATI
DVTLYTNRPERIPTGIKGPVIINGQTFGALLLGQSSASIMGLFVLPGVIDADFTGEIQIM
GHTPYPPLKIEKGQHIAQLVPLLQLTTGLVPKAIDPQDTKGFGSTRLTLLTLDLRDRPKK
PIRITYNTKEISTMALLDTGADTSIVSPEIWPTHWPSYASTQTVT
Download sequence
Identical sequences U3JMF6
ENSFALP00000003960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]