SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000008534 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000008534
Domain Number 1 Region: 8-250
Classification Level Classification E-value
Superfamily CutC-like 1.44e-79
Family CutC-like 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000008534   Gene: ENSFALG00000008185   Transcript: ENSFALT00000008572
Sequence length 253
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603177.1:14536288:14542330:-1 gene:ENSFALG00000008185 transcript:ENSFALT00000008572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGMDDGFLMEVCVDSVESAVNAERGGAGRIELCAGLVEGGTTPSMGLLQVVKQCVRVPVF
VMIRPRGGDFLYSDREVEVMKADIRLAKLHGADGLVFGALTEDGRIDTELCTALLAVCRP
LPVTFHRAFDMVHDPLVALETLISLGFERVLTSGCDSSALEGLSLIKRLAEQAKGRIVVV
PGGGITERNLQRILEGSTASEFHCSARSARDSGMKFRNPNVAMGASFSAPEYSIKVADVA
KVRTLNAIAKNIL
Download sequence
Identical sequences U3K0I0
ENSFALP00000008534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]