SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012044 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012044
Domain Number 1 Region: 41-177
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-50
Family dUTPase-like 0.000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012044   Gene: ENSFALG00000011538   Transcript: ENSFALT00000012093
Sequence length 182
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603201.1:3334503:3343036:-1 gene:ENSFALG00000011538 transcript:ENSFALT00000012093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARCLRWLRHPCGRSMPASEAVLQPSPSKRQKGSGPGEAPLRLRFTKLSENAFAPSRGS
ARSAGYDLYSAYDCVIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVID
EDYRGNVGVVLFNFGKETFEVKKGDRIAQLICERIYYPELEEVEALDDTERGEGGFGSTG
KN
Download sequence
Identical sequences U3KAJ0
XP_005051980.1.66865 ENSFALP00000012044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]