SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001080 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001080
Domain Number 1 Region: 408-795
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.76e-131
Family Ankyrin repeat 0.000000000316
Further Details:      
 
Domain Number 2 Region: 164-426
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 11-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.8e-56
Family Ankyrin repeat 0.0000161
Further Details:      
 
Domain Number 4 Region: 3345-3462
Classification Level Classification E-value
Superfamily DEATH domain 1.38e-27
Family DEATH domain, DD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001080   Gene: ENSFALG00000000997   Transcript: ENSFALT00000001085
Sequence length 3728
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603361.1:196357:458677:1 gene:ENSFALG00000000997 transcript:ENSFALT00000001085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKSDSNASFLRAARAGNLDKVVEYLKSGIDINTCNQNGLNALHLAAKEGHVGLVQELL
ERGSAVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIE
VVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDD
TKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR
NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAP
LLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLL
LDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHL
NIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIA
SRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSMSTKKGF
TPLHVAAKYGSLEVAKLLLQRRASPDSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHA
TAKNGYTPLHIAAKKNQMQIATTLLNYGAETNILTKQGVTPLHLASQEGHTDMVTLLLEK
GSNIHVATKAGLTSLHLAAQEDKVNVAEILTKHGANQDAQTKLGYTPLIVACHYGNIKMV
NFLLKHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNAITTNGNTALAIARRL
GYISVVDTLKVVTEEITTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRP
EDLRELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAMIDD
TVVIPSQQVTTLAKEAERNSYRLSLGPEILDNVALSSSPIHSGFLVSFMVDARGGAMRGC
RHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKL
HLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSENGDS
WKEHFCEYTEDELNEILNGMDEVLDTPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLI
GPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHTELTKKILGNKATFSPIVTLEP
RRRKFHKPITMTIPVPKASSDGLMNGYGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTF
VNECVSFTTNVSARFWLIDCRQTQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARL
RCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFF
AFKENRLPLFVKVRDSTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESDSDPE
PEEEEVDMTSEKNDETESTETSLLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTN
DPSDKSGSIKVKDLEKSAEEEPGEPFEIVERVKEDLEKVNEILRGGSYNREEHVLQKSLS
RQEPLEEEWIIVSDEEIEEARRNAPSEVTEPSHVEVRVDKGTTKKGDLDMTGAKDLKTSI
SHREGKPQALQEEAVDEKVKAVVVSRDSEKKGKESPKTGKPSLQEQQKAASEVKKPFRAK
LREKPKPKEGKVHSSGEKLKLPKLTADEAPAGEPGLKVTGAPEPKAVSPVIEETPIGSIK
DKVKALQKRVEDEQKVRSKLPVRVQAKEGPAEKVPKKPAPVKKPVAHKAQPPVSPSSKTE
RLEETMSVKELMKAFQSGQDPSKNVSGLFEHKSVKQKQQAPEKETPRKKTIPSQSETRRV
SNLKTDKQKDKPSTVSKAEKEPQSKKGKMQTSTIETAKKSGGKDQVKEQSSKKPTEPLPP
VIVAESAKELAAGKGRTCEDQGEPDFQISPDRKTSTDFSDVIKEELEDNDKYQQFRHLSV
TEEGEVNLEQVLTSPFGAAFPTEYGKDGFLPALSLQSAALDGSSESLKHEGVADSPGSLL
DGTPQISSEESYKHEGLAETPETSPESLSFSPKKTDGKIEDPKGAARVHTTAETCSTKEL
SSKEDEKGITERQLDAVTDTRESHSDHVSEEHVPPASEEEADKHKESSSASIMKDISRDK
ESRTTAHFTKSSETRDTALEKEKDIACERRLAVRSPQKLELSLASHDSEGFSPVADDSLT
ISHKDSLEASPVLEDNSSHKTPDSLEPSPMKESPCRDSLESSPVEPTVKACLLGQGPLPS
ALSKAEACPELASVRSRILRDPEGSADDDSLEQTSLMESSGKSPVSPETPSSEEISYEIT
PKMADIPKSATIPEVNEEPEDDSENEPKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDY
KKSCKQDESSVVANSEASREAEISEPTAVVEKDIPMVVTPAAESRKSSSSSESEPELTRL
KKEADSGLLMEPVIRVQPPSPLPSSIDSSSSPDEAGFHPIDSQPCSVRTGEVKAQGKGDK
EEPLILERSCKPSTGTCPSDGCASAESAESKCCDGTGDCEMASPDAPVTRSGCTPHHSVG
DGSQKEFHAESPLTMGQWDATEKDDKPTAPLPSSDLLSTGAVSEEADSLSHGHGTTKYSV
PHDSKLAEGDPADHSALARDSGKADTGYETSHRAGHAEEPLPEYSSLTTGTVEPDNCAAD
AADGSAPYIVSPYENVSSGHFFIDSESEVGSGRSLLSRETYSIAEGKDQAGEALLSRDTG
SEYCSSEEVYMEIEPKPEDGLQTISKGSPTSDSTKLSESTLEDIRDETEKLMGQVVITRT
DVDSDMWSEIREDDEAFEARVKEEEQKIFGLMVDRRSQGTTPDTTPARTPTEEGTPLSEQ
NPFLFQEGKLFEMTRSGAIDMTKRNYPDESFHFFQVGQEPQEEVSLCEEVKEAAEAESSK
LKGSPDPSAPLESEESDIQEQDALNYSTPSPESSDRSEEMIIPIKMGISASSKSPKKETA
ASEAEPLCRTEANTVDSSQVPCPISPEQCAVEDELDFSRVTRLVSSEQGEESPDSSPEEQ
RSVIEIPTALMESVPSCESKSKIPVRTAAAASQSSQQSENKSLSMDDFLDDSQCEGKDDQ
AKPKSKIPVKTTSQKAEPQHSYTDTSVHKPESPKALDVPSAVPVKPDGRSKSESDASSPV
DPKTKRSIKARSYAEAEAEARESEMKFELDSDEATTARSKVFSSRLPVKSRSSTGSRSAF
SPTKESKDHFFDLYKNSIEFFEEISDEASKLVERLTQSEREQELVSDDESSSALEVSVIE
NLPSSETQQSVPEDIFDIRPIWDESVETQIERIPDENVHDRAEDQQDDQERTEERLAHIA
DHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLTQCL
TKINRMDIVHLMETSGIDPMQGHGTRACADTEQSLALDHSEGFSALQEEVYSSRHKQEQQ
RISKDGEPTEHPPLVSEEDVSVSYSPFQDSTPRSEAEVSMAELLRQAHKEQVEAEFSGKP
QDVPGKPSASQQECFATTPGTEQSEGAGKAASGKSAKAETQRAQPPSSALRGDSPIVQEP
EEPQLHRESLAPRRSSLVIVESTEEQMEKSGRGYEEESLEKADSMPEMPPETVTEEQYTD
EHGHTVVKKVTRKIIRRYVTPDGTEKEEVLMQGTPQAPVSVQEGDGYSKVVKRVVLKSDS
EHSEDLNK
Download sequence
Identical sequences U3JE76
ENSFALP00000001080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]