SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000003151 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000003151
Domain Number 1 Region: 30-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000665
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 
Domain Number 2 Region: 154-189,301-308,353-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000132
Family I set domains 0.06
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000003151
Domain Number - Region: 273-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000745
Family C1 set domains (antibody constant domain-like) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000003151   Gene: ENSFALG00000003027   Transcript: ENSFALT00000003164
Sequence length 445
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603552.1:83196:105868:1 gene:ENSFALG00000003027 transcript:ENSFALT00000003164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLSALSLPFIPTFIPTFPGYLTVSIEPLPPVVVGDAVTLKCNFKTDGKMREIVWYRVTDG
GTIKQKIFTFDAMFSTNFSQMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRAT
REKVVLASGNVFLNGSLRVPPPPTSISVLAADTPAPFSRYQAQNFTLVCVVSGGKPAPLV
YFKRDGEPIEAPPLPEPPAGASSWAPRNLLHRDLDDTKVPKPAAAEAEPGAGNPSDPPRG
LAAERDSVTESIPETVVSREFPRWVHVAEPIYYFRHTHAPVSDGTVEARATLTWTLNPQI
DNEALFSCEVKHPALSMPMQSEVTLESDPNPNPNLNPTSSQAKASSGLAPLSPQNEVFPE
PLFTWTRVGSRLLDGSAEHDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFEN
PNIPRGPEDSNGAWCWWRLGFRGGK
Download sequence
Identical sequences U3JK47
ENSFALP00000003151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]