SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006193 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006193
Domain Number 1 Region: 625-1048
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.24e-111
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000344
Further Details:      
 
Domain Number 2 Region: 23-290
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.65e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000007
Further Details:      
 
Domain Number 3 Region: 291-622
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 4.32e-72
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000551
Further Details:      
 
Domain Number 4 Region: 1329-1497
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.02e-55
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006193   Gene: ENSFALG00000005842   Transcript: ENSFALT00000006221
Sequence length 1801
Comment pep:novel scaffold:FicAlb_1.4:JH603224.1:2872288:2918384:-1 gene:ENSFALG00000005842 transcript:ENSFALT00000006221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLILALVLTLGGSQHLNYQPDFSENKVYTFDYETTLLSGLPEKGLARAGIKIKSKVEI
SGIGPKLCLIRVHSIEAAEYNGVWPTSSFSRSLKLSQVLTGQLSTPIQFEYSNGHVGSIM
APESVSDDGLNIYRGIMNALELSIKKTQNSYSLQEVGIGGICNTTYAIQENKRANLVYVT
KSKDLNSCEEKVQIVTGSAYTHPCKTCQQRNKNSRATATYNYKIKYTRSEAVITQADVEE
IHQFSPFNEITGGNAIVEARQKLTLTDVQKQRAEVPPKEYQNRGSLQYQFGSELLQLPVH
LFKIEDVESQIEECLQELVEATSDQLPSDAPAKALKLLHLFRAASEENYESVWKQFSSRP
AYRRHILDIIPAVASHRALRFLRHKMERQELTSWEVTQTVLVALHSSTPTRDVMEEATLI
VKKHCPRSSSVLGKVCHLSYASLCHKQCSSSDPCSECLQLLHGFAGEALSKSSTEEISLA
LKALGNVGHPASIKHIKKFLPGYAAGASDLPLRVHATAVMALKNIGLKDPKVVQAITLEI
FLNQKIHPRIRMLAAVVLLETKPGLPIVMTLADAVLKEPSMQVASFIYSHLRALGRSTAP
DLQVMASACRMAIRALSPKFDKSGYQFSKVFRFSIFKEFLMSGLAAKYLVLSNAGSLIPA
MAMSQLRTHFLGRVADPLEVGITAEGLQEIFAKGYSPDRDWETDFDFKKILKTLSDWKAF
SSDKPFVSGYLKMFGQELFFGGLDKNTIQNVLQAWYGSDEKIPSLRRIISSLQSGVGRQW
TKALLSSEIRHIVPTCTGFPTETSFYYSSVTKVAGNVQAQITPSPKSDFRLTELLNANIK
LRSKTSLSMAKEMTFVMGINTHTVQAGLEARTKMNAHIPVNVVATIQMREKSIKIEIPPC
KDETNIISLRSKTFAVTRNIGDLAASKTTPVLLPEAVPNIMKTSFNSDSASGENENIGDR
QSAEDVSSGNPFSSEHSSYQKEPFVQSMCFNASTFGVQVCIDKKSVHAAFIKNLPLYYLV
GEHALRMSFKPVYTEAPIEKIQVTIQAGDQAPTKMVRLVTFEDPEAQASSRKEAIKKVKK
ILADTDDQETRKYRSSSSSASSASGSAESTTSSPSSSDSDGRASQEGAQINLKTGRSKAK
GKKFYPFGAGIKHKAKKQSKSTSFPLASAAEGERSVGEQKPRAQSSSSSESTGASRWHSK
PDKRAETSHSKRRVNGGSTHDISTEWESHLPKVYSLRFKSAHIHWFLGNHGKIITQIFSE
SRFSTHYDTKHPDHKGSSSSSSSSSESHHHGENSAHNSKRSRKVSIHYHDHSHGSSLTRE
RNFLGDVIPPGITVVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVVVQLAETNWKACAD
AVIVPLKAQARLRWGKECQDYRIAAAATTGQLARKPAAQLKVQWGKLPSWIKKTSTAFMQ
YIPGAALVLGFSEVHQRNPSHEFIVRAAATSPRTIDTVIKAPEVTLYCQGFRLPFTLPLG
PSPAYETRDITAWNLFPEIASQIAQEDQSTCEIRERDFKTFDRVSHSYSFNKSCNLVAVQ
DCTEHPKFIITTRKVDPQSFSREVHINTTLANITICPASNSSLLVACNEEQVLSHSGGSE
YEKGNVKIYKNGKTVTVEVPELGLKKVTFDGVNLKVTAASWMRGKTCGVCGNNDREKENE
FLMPNHRLAHSCSAFVHSWVLLEETCSGGCKLQRSYVKLNRNPTIDGEESTCYSVDPVLK
CMKDCTPIEKASVKVGFHCFPKETAVSLLEWQKSSDKKSASEDVVESVDADIDCTCTGSC
S
Download sequence
Identical sequences U3JTT9
ENSFALP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]