SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006236 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006236
Domain Number 1 Region: 966-1061
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-17
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 2 Region: 117-214
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000684
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006236   Gene: ENSFALG00000005969   Transcript: ENSFALT00000006264
Sequence length 1201
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603363.1:998598:1139724:-1 gene:ENSFALG00000005969 transcript:ENSFALT00000006264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRFVCLLFCGYIALNLGNTQKLPRVKRQSLKVQINATDDTVCMRYLRPSQSTKLEGFVL
GYGSNLFSNQYIPLPAEGKNYLTELVADAEPRYLVSVRPARVSNNKKSCSGRNKTQKPLQ
LVVGTLSPTSVFLSWGILVNPQHDWTATSNCASDRFYTVRYREKGKDKKWVFQLCPATET
VIDNLKPNTPYEFGVKDNAEDSIWSKTLNHKTILSSKKVNGQLQNMYKLVPNSQTQIILS
DNKKLVPVTIIKQIIQNRTQAKAPDSSSLPGAILVHLIVPGLNESQQKLPPLLTIDDIPQ
ASRKKLAKNETGVWPAESKTPEVQEISPQSLPGSENSVFRNSVEYLCQIYKLKHTILVLK
KPPEQKKPSQTNRSIFFPSVKMILFVLSPNRFPEFTEEKQTVSSGSKPSGTIWEVLEEIW
SIRGKECTKRCRVVQVPVLLSYQVTSTPQTSTSTKIIEIHAAASESILESFTPKTSRPFQ
WPRVTLAPKPPLLEPKTSQTVEQPKSTLATKEAKLTTSASKPRPSARPQKPRTKPGPQTA
TIPVSVTTRSPYTYERPKTAEVYKPKTPPKPHIPQAKDVLESMTLRPDQLKPTIVPREPQ
HVPFKPRTSLSPEVPRTKPASKDTYHRPSKPKTSPSPRVPPTRASQKESRRVPSKPRASP
SPDVPHTKPALKEPQRIPFKPRATPIPDAPYRKSEILPTFDERDTTMIPHIPERTKEEEI
KTSFKAIHPTTPQPIITKSSTTTGLSRATMAPYKTRLTSARPKPSDKSQTRPAFSRTTLA
PARTKAPGLPKNSGYQIKKSSVSLPTSPLRTCYSILKHCFIKLTTPPGPQHPPIPPARPT
QMRRKPLPPNTVTGKPGSPGISALSDVPAPPLLVTAKPAGPTSPVRTGTLHKTPTAFATP
EYYVDATVFSSSPTSETDSSGKPRYQAPHVKYMKKDDDVPCSITSSLEHFPQEEVGSKEE
PTRPPQNPPTNLTVVTVEGCPSFVILDWEKPDNDTVTEYEVVSTENGGTDGEKEKSIITT
NQTHSTVENLKPDTSYEFHVKPRNPLGEGPSSNVVAFSTESADPRVSEPISMGKDAIWTE
IPFNSDTYSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGED
HCQFVDSFLDGRTGQQEDLPVKDGFFRAVRQEPVKFGKIGGETQINYVRWYECGTSIPGK
W
Download sequence
Identical sequences U3JTY2
ENSFALP00000006236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]