SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006313 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006313
Domain Number 1 Region: 625-1051
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.02e-106
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000934
Further Details:      
 
Domain Number 2 Region: 24-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.84e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000118
Further Details:      
 
Domain Number 3 Region: 290-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.44e-74
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000452
Further Details:      
 
Domain Number 4 Region: 1252-1421
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.85e-51
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006313   Gene: ENSFALG00000006054   Transcript: ENSFALT00000006342
Sequence length 1722
Comment pep:novel scaffold:FicAlb_1.4:JH603224.1:5022083:5045194:-1 gene:ENSFALG00000006054 transcript:ENSFALT00000006342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLILALVFALVEGQKQDLEPVFHMGKTYLYSYESVIVHGLPDRSLAMAGLRLASKVEI
SRVSHSDHLLQIQSPKLEEQNGFWPIDSFIPSPKLSETIAACLSQPFKFEYTEGRVGSIF
APEDCPILCTNLVRGILNMLQITIKKSQNVYELQEAGIEGICQTRYVIQDDTKNNRATVS
KSKDLTDCQDKAVKNLGMAHLRPCPTCPLKARNIKGTVTFTYKMKYDDSGASLTSATSDQ
VYQISPFNEPNGAVVMEARQELSLVGIKRPPISAPTSPLQKQGSLRYHFSGELLQMPIPL
IRIKNPDLQLTETLRQLVQNNEKGATKEASAKFLQMVQLFRVATLDQIESLWLQFVNELA
YRPWFLSAICAAGATDTFRFLKQKIHDEKLNIWEAAATLPLAFHFVTPNKKTLEIASTFL
TCPQIQKVLMHRIIVYLGYGSMVNKYCAQALLCPNELLQPLHDLATEATSKGDAKDMSLA
LKAMGNAGEPASIKRILKFLPTFSSAAASLPNRIHVDAVLALRKIARKDPAKVREITLQV
FLDSTLAPNVRMVACVVLFETKPALPTVAALASSLLTEPSLQVASFAYSHMKALAAGKIP
QLYKLSAACNIAIKLLGPRLDRLSYRYSKVIQISDYSSQYQAGAIWRVYLMNSPSTMFPS
DIITKVRGYYANTAMDIIEVAFRSQSLSKLMRKQNIPFAEYDTYKTLKELGKSLLGWKEL
PAEDPLISAYIKVLGQEIAFVDIDKDAIQQMMTSLAGSSDWQPVVKKVVEEVQRGVSGRW
AVPVMVGEVRHIVPTIAGLPLELGLGAAAVAQAAADVDVKLSPAVADNFRPSQLWETKMD
IHADIRPKAYFHIIAMMGINTQYLQSGFEFHAEFSANTTMKFDARINMKEKNLKIETLPC
QQEVELAAVRSEVYAISRNMEEVDFEKKSQIVPKAEIPNISDQLLQSTEGSSKPGSWKQS
SIPNVISKGYQQDPEEVYHNSAGRRFYARRFCKKFESLGCSTCLSLKSQNSAFLRNTYLH
KLFGEFEAKVILKPVSTDADIDKIQLEVQAGPKAASKIIEVSSSGSKEEEETSPFQDIRA
KLKKILGIDNVFMAANKTRRRTKRINREYQTADTGLWAEPSTSLLSSSSSSSAASSADGT
EPGDHHRKDEIRQSGTERGSRSRSSSGSSASSKACSSSQADHSGDRHCSGDSEYSNQQAN
PPVYQLLFKPADEQDTGGEILNISISSSSSSSSDEDVSRAMSQPKFLGDSKPPVLAAVLC
AIHRNKQQTGLQLVLYTDTQPKRWRMQMFGSSITGPSRWKLCADASVINYRKVSGSLKWG
KDCQDYQIATQIATGQFAVYPAMQMKLEWLKVPSIIRTTARWVYSFLPGAAYMLGFSQRQ
QPGPSHQATLVMALTSPRTCDVVFKMPELTIYDTAISLPLPVPSHPGTMITFPSSDWKVF
SQATLSVFESLKGHCTVFQNKITTFNGVEFNYSMPANCYHVLVQDCSPELKFLVMVKRLE
ESADLIAINVRLASHEVDMYVSNGLIQLKINGVQAPRGLPYTSNSAASMLISSEKKGLTL
KAPDYGIDKLYYDGHRLEVQVAFWMAGKTCGICGKYDAETEREYQTPSGYLAKDAVSFGH
SWIISEDPCAGACKLQRKLVKSEKPVSFEKTAAKCFSVEPVLRCVKGCSATQTVPVSVGF
HCVPADSALSLDGQPRLDQKSEDAVSTVSAHTACSCQQQCPA
Download sequence
Identical sequences U3JU59
XP_005050329.2.66865 ENSFALP00000006313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]