SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006319 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006319
Domain Number 1 Region: 146-239
Classification Level Classification E-value
Superfamily TAFH domain-like 7.98e-35
Family TAFH domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 534-582
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000117
Family TBP-associated factors, TAFs 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006319   Gene: ENSFALG00000006055   Transcript: ENSFALT00000006348
Sequence length 746
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603182.1:5347918:5405782:-1 gene:ENSFALG00000006055 transcript:ENSFALT00000006348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVFFSTGTVLIRSSNGHLMLVSQQAVARAQNQTQNNTSVRPSVPTSTPAIRICTVQNSGT
QLVKKIAAAPVKTLSQTTNAVVSTVQTPAVIKPAAATASVTTVTAVKPLSTGTPVKLPVT
GPPAQAISQKAVSVKAEGTTVAQTSASTEMLENVKKCKNFLATLIKLASSGPQAPEMGQN
VKSLVQNLLEAKIEPEEFTKKLYIELKSSPQPYLVPFLKKSMLALRQLMPNPQSFIQQCM
EQPAPAQEVVSTCTSAVPAPSTGAATSAVAATAPPVVKPAPASVAAPAPVVVTPVLDSTS
AAASLQAVKAIPSPAVVTASLSPAAPILTTSTASSRLTAVQPGKPAFTSVVPKPSLQAAK
PVLVSTVASSAATPLQPLKPVIGTPVGIKISQPSSILTQSVGAQQVVKVKQLVVQQPSRT
IVKQVSTLPHPSVLTLPAEKKMPLNTLVQTNQFPAGSILKQITLPRNKILSLQASPVQKV
KMKENGATSFRDEDDLNDVTSMAGVNLTEENACILAANSELIGTVIHSCTDEPFLSSEAL
QSKILNIGKRHDIIELNSDVVNLISHATQERLRGLLEKLTVIAQHRVSTHKGSDKYIVCS
DTRAQLRFLEKLDHLEKQRKDEEEREMLLRAAKSRSNKEDPEQLRLKQKAREMQQLELAQ
MQQREANLTALAAIGPRKKRPLDSSNVGSGLEGLNGNGIAGSSGFSLTKQMHCPRVTRVC
LRDLIFCMEQEREMKHSLHLYRALLK
Download sequence
Identical sequences U3JU65
ENSFALP00000006319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]