SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006425 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006425
Domain Number 1 Region: 635-1059
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.1e-112
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000137
Further Details:      
 
Domain Number 2 Region: 34-299
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.9e-82
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000147
Further Details:      
 
Domain Number 3 Region: 300-633
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.06e-80
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000221
Further Details:      
 
Domain Number 4 Region: 1419-1589
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.34e-60
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006425   Gene: ENSFALG00000006095   Transcript: ENSFALT00000006454
Sequence length 1891
Comment pep:novel scaffold:FicAlb_1.4:JH603224.1:5048750:5073851:-1 gene:ENSFALG00000006095 transcript:ENSFALT00000006454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRAPFTFTMRGIILALVLTLVGGQKFDIDPEFSSRKSYLYSYEGWVLNGLQEKNLAKA
GVRLSSKLEISGLSENTYLLKIRSPQLEEYNGIWPRDPFTRSSKITQLLSSCLTRPFKFE
YSSGRVGNIYGPENCPDTCVNIVRGILNMIQITIKKSQNVYELQEAGIGGVCHTRYVIQE
DKKNGRVSVTKTVDQNNCQEKVVKSLGTAYIYPCPADVMKERIIKGTAAFSYKLKQSDSG
TLITEVVSQQVYQISPFSEPTGVAVTEAKQQLSLLEVRSERGSSPDVSMQSYGGLRYQFP
AALPQMAVQLIKTKNPEQRIIETLQHIVLNNQQDFHDDLPYRFLELVQLCRTTSADTFES
LWRQCSDKPRYRRWLLSAVSATGTAEALKFLKSRIRSDDLSYLQALLSVPFALHLTKADE
HTVPIAADLVTSSRIQKNPMLQQLASLAYSSVVNRYCSQTSACPKEAVQPIHDLADEAIS
RGREDKMKLALKCIGNMGEPASIKRILKFLPIFSSSASDIPIHIQIDAIMALRKIAWKDS
KTVQGYLIQILADESLSPEVRMMACAVIFETRPALPLITTIANVAMKESNLQVASFVYSQ
MKALSKSRLPYTYNISSACNIALKLLAPKLDRLSYRYSKVIRIGGYFDNYKIGAAGDVFV
MNSPGTMFPSAIISKLMAYSAGSVADLVEVGVRVEGLTDVITKRNIPFAEYSTYKKIKEI
GKALLGWKELPTETPLISAYFKLFGQELAYISINKEVLQQAVKAVLEPADRSALLKRLAA
LLRSGAAGHGTQPLWLAELRHVLPTCTGLPLEYSSYGTAMARAAASVDGKIAPPLTGDFK
PSQLLESTVQIRSDITPSLYIQKFATMGVNTEYFQQAVEIQGKVLTRVPIKFDAKIDMKL
KNIKIETKPCREKTEIVVGSHKAFAVSRNLGELGVEKRTSILPGDASSNIVEEPFKPSDR
ASSEDFTKQEADSTSKKHGYSSQEDLRHVVGRKSKKQDICVKVHHLGCQICFSRRSRDAS
FLKNTYLHRLVGEHEAKIVLTPVETEAGIDKIQLEIQAGSRAASKIIREVNSESEEEGES
SLQEDIQAKLKKILGIESVFKVANKTRHQKKRPSKKENTVLTELGADPDTKHPSSSSSAS
SAVSSSSSSAVSARRKEAGDEDENDQEEQAKNKDASSKSSSSSSRSSKSSSSSSKSSKSS
SSGRSSKSSSSKSSSSSTSGRSSKSSSSSSSSGRSSSSSSSSSDRSSKSSSSSSRSSKSS
SSSSSSSDRSSSSSRSSKSSSSSDRSSSSRSSKSSSTSSRSRSRSSSSSSSSSSSHHSHS
HGHHSRYRNGSSSSSSESLSHHSHEHHSGHLEGGSSSSAYSKIWEAHEIYQYRFKSLHTQ
EFPKTKLADDQISSSHSSARSSRASSRASWPKFLGDVKAPVLAVFLHGLRDDKKIGGLQL
VVYADIDSIKPRVQVFVSNLTDSSKWKLCADASVLNAHKAAAYLKWGRNCQDYKVSSELV
TGKFAAHPAVQVKLEWPKVPSSVRSIAEWFYKFVPGAAFMLGFSEKTDKNPSRQARVIVA
LTSPRTCDVVIKLPDVTLYEKAMRLPLSLPVGPRIPASELQPPIWNVFAEAPSAVLQNLK
AQCSVSSNKITTFNEVRFNYTMPANCYHILAQDCSSDLKFLVMMKNVEEAVNLKAINIKL
GNHEVDMRPASGRVRLLLDGAESPTNVSLTSAGASLWIHSENQGLALLAPAYGIDKLYFD
GYTFKIQVALWMAGKMCGLCGKYDAECEQEYRMPNGYIAKDAVSFGHSWILEEKPCRGAC
KLRHSFVKLEKAVQLAGVESRCYSTEPVLRCTKGCSATKSAPVTVGFHCLPADSATSLTE
KQTKFDQKSEDIQDTVDAHIACSCEDAACSA
Download sequence
Identical sequences U3JUH1
ENSFALP00000006425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]