SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007380 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007380
Domain Number 1 Region: 686-977
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-86
Family Complement components 0.00000909
Further Details:      
 
Domain Number 2 Region: 1057-1197
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.32e-33
Family Alpha-macroglobulin receptor domain 0.00092
Further Details:      
 
Domain Number 3 Region: 522-574
Classification Level Classification E-value
Superfamily E set domains 0.000000252
Family SVA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007380   Gene: ENSFALG00000007075   Transcript: ENSFALT00000007412
Sequence length 1231
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603257.1:3497694:3539848:1 gene:ENSFALG00000007075 transcript:ENSFALT00000007412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYVLPKFDVMITTPLYYSLRDEDVAGVVSAKYTYGKPVKGTVTVTCLSVSYWTNKRNIT
TTMEINGSVNVTCNKLMLQNLNAEQSWHQGDSEYTEPIEMIAVVTESLTGISQNSSTIIF
PKQSDYFIEFLDYTRVIKPSLNFIATLKVSRSDSSQLTAEERHNLVTITAQQSDLLFHHS
SLSHLENEATEERNLTVHVLNYTVPENGVIDVEFPILFDTKTLRVQAEFLSSKTDIGVYD
VFSSPSQTYLQLKTKSQDIKAGKPFELSIASNKPVRQYHYLVLSKEQIMDSGTKSTRTFT
LTADNSWAPLVSILVFYVDELGVVVNDALTVPIQPALDDKIKISWSKDKAKPSEKVSLKI
NTTEPGSVIGLSVVDKSAKLLGESSDITEESVLHELSLYSTVQYFPLVRGSYGIFQKCSL
WVSTDAVLEEDKEHFLYGGMIPIEDGFGEDMPVSKNGPPDFNNLYVRTHFPETWLWVDAE
MRSDTETTMDAIVPDTITSWVASAFVISENGGLGVTTAPVELEVFQPFFIFLNLPYSVVR
GEQFILEVNIFNYLKEEAEVTVILDMNDAFEITLTSNEINATANQQSISVPSEDGKTVQF
PIKPKQLGEIPIKVTAISSAASDAVIQKVLVKAEGLEQTYSETILLDLVGNKRQAVSKTL
EFTFPSDVVSDSERVQVTAVGDLLGPSINGLSSLIKMPYGCGEQNMINFAPNVYVLQYLI
KTRQLREDIRSRAVSFMRKGYQRELLFQRDDGSFSAFGNEDPSGSTWLSAFVLRCFLQAR
PFIDIDEDVLMDTAKWIVRHQKLNGEFQEPGKVLSSDLQGGINNPVTLTAYIMSSLLGFP
DKQHAYAIKTATNFLEDKLEEGISDNYTLALVTYALSWAKSTRAKEALNVLNQRAERQGE
FRFWVTPASEISDSWQPRSIDIELAAYALLSHFHQDRVAEGIPIMKWLSHQRNHLGGFSS
TQDTVVALQALSLFAALTAGGKTEMDITVTAPSLEMPEIFSIDTRNRFLLQAKEIPPAKQ
MAITVSAEGMGFAVFQLNVMYNTKHTDQRLRSVPNREVFDLNVDVKDDKDDKNHLTLNVC
TRYFGSGTAPSSGMVLMEVGLLSGFSVSPDFVPLGNTVKKTEKDNGKVNLYLDSLNETQV
CVDIPAVRDFKVANIQDASVTVVDYYEPRRRAVRSYNSEVMQSITSCDFCESDCNLCHRD
GSAALLQHSSLASLFCVLFVLHVNLLCSWVL
Download sequence
Identical sequences U3JX76
ENSFALP00000007380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]