SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000011092 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000011092
Domain Number 1 Region: 584-677
Classification Level Classification E-value
Superfamily TAFH domain-like 5.36e-36
Family TAFH domain-like 0.00000307
Further Details:      
 
Domain Number 2 Region: 872-919
Classification Level Classification E-value
Superfamily Histone-fold 1.81e-17
Family TBP-associated factors, TAFs 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000011092   Gene: ENSFALG00000010629   Transcript: ENSFALT00000011137
Sequence length 1085
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603232.1:2125434:2163614:1 gene:ENSFALG00000010629 transcript:ENSFALT00000011137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFLNTEVDEKVVSDLVGSLESQLAASGHHHQHHKAQEPLRAAGGLLGNHV
VSSSSSSSSPSPSPGGVVVGGNANAQTESSSGSKMGLSAPEITKAGAGGVQGGVINHNTR
SQTSALDGATTTSTSTTTAAAGGSEVTAAPGTLSQGKSVVISTMATALSTRNGKIGTTTV
QTLNGSNVVMNSHHTGSAAFSGTPVTTNPAPAPAVAPLVNNGPGSVGKGNAVNAVLPSAS
NTVIQTSFLNTAVSSASSSSPTVISSQPPPSVGTGAPTVTLVRPPIHTAGPTVAAAGAAT
QNGSNTVINSTISVTSLVNSQSGSTVPAAPATQVIKSESPKTIVQAVSQQQTLATGGQPS
TTGGNMIIGQTMQAGLSNVAPNPGGIPPAAPGTPTGMAKGTANTVAQSLPRTPTPTTSGI
RATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQ
SQPQNTLTPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPTTTLQ
RPPVVQPQIVLGGTAQTTTLGTATAVQTGTPQRTVQGTTATSTAATETMENVKKCKNFLS
TLIKLASSGKQSSETAANVKELVQNLLDGKIEPEDFTSRLYRELNSSPQPYLVPFLKRSL
PALRQLTPDSAAFIQQSQQQQPTTQATIATIPSAAAVLLSSSVQRTAGKATATVTSTLQQ
PVISLTQPTQVGVSKQGQSTPLVIQQSQKAGALIRPPQVTLTQTPMVALRQPHSRIMLTT
PQIQLNQLQTVPVVKPAVLPGNKAIATVSTQVAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLFPAPLQRRILEIGKKHGITEIHPDVVS
YVSHATQQRLQNLVEKLSETAQQRNISYKDDERYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DSPGSGSGTEGSGSSAAVPGSSGVGTTRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK
Download sequence
Identical sequences U3K7T8
ENSFALP00000011092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]