SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000011399 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000011399
Domain Number 1 Region: 271-442
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-16
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 2 Region: 74-251
Classification Level Classification E-value
Superfamily Fibronectin type III 4.42e-16
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000011399   Gene: ENSFALG00000010919   Transcript: ENSFALT00000011444
Sequence length 711
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603251.1:1254203:1274410:1 gene:ENSFALG00000010919 transcript:ENSFALT00000011444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSKYSVKFCQSATESCSFSHRENAYNNDFCFQVKAKNVLGESLTECVPISLQKIEKFAP
PEILSVKKIPGIKQLLTVTWKMPEKIIPLKSIICQLQYRNLYSNFTEFVNVSLNSKKGGV
IGSCNLTGLWDSTDYSVAIRCINNESVFWSGWSGEKNGSTEEKAPSGKVDLWRVIESSHS
SRNRSVHLMWKPLKSFPPSGRILGYKIQYFPEKKTAHKRTNNSTEKKITLLLNEEAHIIS
VTAYNSAGESPEAILRIPSIDEKSNQAIETVMTSTTNEEVVVQWITSEPETTKYVVEWYE
ELEMDPFGRSWQYVSNSTEWKNNKKNFKPFICYNISVYPLYGSNVAAPSYAQIYAQEKKP
SEGPVADTGILGKNEVTIKWNEISKAKRNGFITNYTIFYRPEDGKELNETVNSDVLQYRL
KSLQANTQYTVQIMASNKAGGTIGEQKTFKTLKFDKEDFFFIAIPVGISVLCLIGLWITC
VLKKHAFKKVCWPDIPNPEESLAVEWPLASSMNNSFLKRLSSQTKSVDFEDINALEYCFP
EERPEGSLLINYENHVSECTDINTKDITNRDEKILRNEENEVAKCFSPSMPYIIAEQFTR
SQMHSALIPVKEAQPIEMVGNVLCGSQQNPTKNEESDDEEVLKLEDFSEKALFNPYLKNS
VKTREFLVSESLPEHSMDEHKSQSNVSPPFQPNVPGQSYITLDMFRLAKAQ
Download sequence
Identical sequences U3K8P5
ENSFALP00000011399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]