SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000015383 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000015383
Domain Number 1 Region: 16-141
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.0000068
Family Group II chaperonin (CCT, TRIC), apical domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000015383   Gene: ENSFALG00000014768   Transcript: ENSFALT00000015448
Sequence length 213
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603173.1:5715482:5716120:-1 gene:ENSFALG00000014768 transcript:ENSFALT00000015448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAELHAAVPGLPLASSRLLPGIVLRRDFAVYCPTDGQLRALLVTEPLRPALTAPGVEFVV
DSEGQYQASLRWITDRTEALMKRLQSNDVKLLLSSVKQEEVVIYYAKLYGVSVVECLSAE
EVALIREITGVSPYTPFGDNMDREITETAVVTFCQPLLLVSKRCVHIGFSSVCAFQPHCL
ILCGPVDGVNEQHAAAVQEAFTMLQQLFKTVHQ
Download sequence
Identical sequences U3KK29
ENSFALP00000015383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]