SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010961 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010961
Domain Number 1 Region: 6-247
Classification Level Classification E-value
Superfamily CutC-like 6.41e-74
Family CutC-like 0.00000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010961   Gene: ENSPSIG00000009925   Transcript: ENSPSIT00000011017
Sequence length 250
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210275.1:78761:93046:1 gene:ENSPSIG00000009925 transcript:ENSPSIT00000011017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGFLMEVCVDSVESAVSISCPGAGRIELCAGLLEGGTTPSIGLLQVVKQCVQIPVFVM
IRPRGGDFLYTDRELDVMKADIRLAKLHGADGLVFGALTEDGRIDTELCTALLAVCRPLP
VTFHRAFDMVHDPLVALETLVSLGFERVLTSGNSSALEGLPLIKRLTEQAKGRIVVVPGG
GITERNLQRILEGSGAPEFHCSARSARDSGMKFRNSSVAMGASLSTSEYAVKVADVATVR
TLNAIAKNIL
Download sequence
Identical sequences K7FSF1
ENSPSIP00000010961 ENSPSIP00000010961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]