SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017174 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017174
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily dUTPase-like 4.19e-38
Family dUTPase-like 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017174   Gene: ENSPSIG00000015285   Transcript: ENSPSIT00000017252
Sequence length 104
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212494.1:1615277:1625816:-1 gene:ENSPSIG00000015285 transcript:ENSPSIT00000017252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKAIVKTDIQISLPSGCYGRIAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKQD
FEVKKGDRIAQLICERIFYPELEEVQALDDTVRGTGGFGSTGQN
Download sequence
Identical sequences K7GA63
ENSPSIP00000017174 ENSPSIP00000017174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]