SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019917 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019917
Domain Number 1 Region: 16-45
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0000523
Family Recombination protein RecR 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019917   Gene: ENSPSIG00000017655   Transcript: ENSPSIT00000020011
Sequence length 97
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208512.1:6234:7342:-1 gene:ENSPSIG00000017655 transcript:ENSPSIT00000020011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPACPGGHSWSPDLDKCMDCTICLHLTKNDFCTTCSGEPRPQDTRQWLVVGGVLGGVAV
LGLVGGALLWARCRKKEKFTTPIEETGGHSGEESLIH
Download sequence
Identical sequences K7GI06
ENSPSIP00000019917 ENSPSIP00000019917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]