SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000000989 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000000989
Domain Number 1 Region: 101-259
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 5.34e-29
Family Retrovirus capsid protein, N-terminal core domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000000989   Gene: ENSPSIG00000000991   Transcript: ENSPSIT00000000991
Sequence length 268
Comment pep:novel scaffold:PelSin_1.0:JH208420.1:287838:288988:1 gene:ENSPSIG00000000991 transcript:ENSPSIT00000000991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPEDSDSEDGGPEDPFDTGTAAVGVGPDSYPSLKPVKALAASAPTAEQILQTQRLQAVS
QSSIAAPLPFAPALAPASSYRSASHTVAPYGPPLVAPSHNEQAGGLSECCREALRRGDVQ
LLQAFPIVYAPERPARHEALPYELVKELRKFVKDYGLQSSYMMNLVVAISESYVMALHDC
RTLLRLLLSPAQYAVWDTEYHDGVTLQVMDNITNGVNVGIDELIGQGQYATPQAQAQMNR
LVFTQATSLTLRALRQGPSFATVRQGPQ
Download sequence
Identical sequences K7EYX9
ENSPSIP00000000989 ENSPSIP00000000989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]