SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000002672 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000002672
Domain Number 1 Region: 144-236
Classification Level Classification E-value
Superfamily TAFH domain-like 4.19e-34
Family TAFH domain-like 0.000021
Further Details:      
 
Domain Number 2 Region: 511-559
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000109
Family TBP-associated factors, TAFs 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000002672   Gene: ENSPSIG00000002612   Transcript: ENSPSIT00000002681
Sequence length 724
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209872.1:1191485:1289939:1 gene:ENSPSIG00000002612 transcript:ENSPSIT00000002681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTGTVLIRSNNGQLMLVSQQAIARAQSQTQNNAGTRPSIPTSTPSVRICTIQNTGTNLL
KKVVATPVKTVSQTTNSVASTDRRPAVVQTAAATNSVMTVTTVKPPGTGTPVKLPVSGPP
APSVSQQATSVKGEGTTVAQPNTSTETLENVKKCKNFLATLIKLASSGPQAPEMGQNVKN
LVQHLLEAKIEPEEFTKKLYVELKSSPQPYLVPFLKKSMLALRQLMPNAQSFIQQCVQQQ
APIQAVVSTCISTAPTSSTVVTTSALATTSLQPVKPVLASAVVTGAQTVKPVPSTIRVTT
AAAPLQTVKPVSAPFQPANPVHMSAVATTSLQAVKPIFASPVATTTTTPLQSLKSVIGTP
ISIKITQPKSTVAQSVHAQQAVRVKQLVVQQPSGSIVKQVATLPQTATLTLQKPGEKRSP
LNALIQTNQVPAGSFLKQITLPGNKILSLQASPVQKNKIKENGTTSFRDEDDINDVTSMA
GVNLSEENACILATNSEVVGTLIRSCTDETFLSSEALQKKILDIGRRHDIMEPNSDVVNL
ISHATQERLRGLLEKLTVIAQHRMTTYKDSNKYIMSSDTRAQLRFLEKLDHMEKQRKDEE
EREMLLRAAKSRSNKEDPEQLRLKQKAKEMQQLELAQMQQKEANLTALAAIGPRKKRPLD
SPNLGSGLEGLNGSAAASGSSGFSLTKQLFRPRITRVCLRDLIFCMEQEREMKHSLALYR
ALLK
Download sequence
Identical sequences K7F3R2
ENSPSIP00000002672 ENSPSIP00000002672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]