SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007371 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007371
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily ARID-like 9.81e-34
Family ARID domain 0.00034
Further Details:      
 
Domain Number 2 Region: 522-599
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-16
Family P4 origin-binding domain-like 0.0097
Further Details:      
 
Domain Number 3 Region: 280-489
Classification Level Classification E-value
Superfamily ARM repeat 0.000000309
Family Clathrin adaptor core protein 0.04
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000007371
Domain Number - Region: 1621-1646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0724
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007371   Gene: ENSPSIG00000006686   Transcript: ENSPSIT00000007412
Sequence length 1824
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209564.1:2279094:2462043:-1 gene:ENSPSIG00000006686 transcript:ENSPSIT00000007412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSTGKTQPDQRRKGLAFLDELRQFHHSRGSPFKKIPVVGGKELDLHALYTRVTTLGGF
GKVSEKNQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKP
QLPIGAIPSSYNYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVC
TLLSNESKHVMQLEKDPKIITLLLANAGVFDDTLGSFSTVFGDEWKEKTDRDFVKFWKDI
VEDNEVRDLISDRNKSQDIPPEDWILESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEE
GNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFKTTHLMFHTVT
KCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQESYKEIICHLTLPDVLLVISALE
VLYMLTEMGEVACTKIAKVDKSIDTLVCLVSMDIQMFGPEALTAVKLIEHQNSNHQVSEI
RPQAVEHVSSQAHATAVPASRAAQHVVPPPGIVEIDSEKFACQWLNAHFEVNSDCSVSRA
EMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDPNNNGQAHIHVVGVKRRA
IPLPIQMYYQQQPTSATPVVRVDSVPDVSPSPSPAVGQQDGPQRKGNHFQRTPVNHQSSN
LTATQMSFPIPGVHTVAQTVSRIPQNPSVHTQHQQNATVTVIQNKTPISCEVVKATVIQS
SVPQSAVPVTIAVGGAAQASNQNHNSAGPQPSVAVVSSQTLLHHQPVIQQQSPLHAVVPG
QIPSGTPVTVIQQAVPQGHIFGRVQNLPSCTSSVSQGQQLITTSSQPLQTSSQQPASGNQ
QQDTVIIAPQQYVTTSAPNIVSATTVQNFQVAAGQMVTIAGVQNPQTSRVGFQNIAPKPL
PSQQVPPTVVQQSMQQQQPPSQQSVVIVSQPAQQGQTYAPAIHQIVLANPASLPAGQTVQ
LTGQPNITPSSSPSPGPVTNNQVPTVMSSPSTTPQSQGPPPTVSQMLSVKRQQQQQHSPA
PSQQQVQVQVQQQQPVQMQVQPQQTNAGVGQPSSGESSLIKQLLLPKRGPSTPGGKLILP
APQIPPPNNTRAPSPQVVYQVANNQAPGFGVQGQSPAQQLLVGQQNVQLVQSAIQPQGAV
QTVPISNLQILPGQLISNSPATIFQGTSGNQVTITVVPNTSFATATVSQGNTTQLQAGVG
LQVQTLPATQTPPAGQSPCAAAAPPFKGDKIICQKEEEAKEATGLHIHERKIEVMENPSC
RRAANTSNGDAKENEMQVGSLLNGRKYNDSSLPPSNSGKTQNEANQCLQVSNGPSLELGE
NGAPGKQNFEQMDTEEIKSDLKKPLVNGICDFDKGDGSHMSKNIPNHKTSNHVGNGEISP
VEQGNTDATQQETAKGDQGERISNGPVLTLSSSPIVSGTQEAAKLLTQQLSGTNTDLPNG
PLASSLNSDVPQQRPSVVVSPQSTASVIQGHQIIAVPHSGPRVSQSTLSSEVRPTNGTAE
CRTVKRPAEDNDRETVPGIPNKVGVRIVTISDPNNAGCSATMVAVPAGADPSTVAKVAIE
SAVQQKQQHPTTYIQSMVTQSTPVTPVPTVQVQGQQINLQPSSYPAPSQPGEQMKKPGQN
FMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRFSFITHLQDKHC
SRDALLAGLKQDELGQAGNQKPSNKQPTVGASASTPRAQKAIVNHPSAALMALRRGSRNL
VFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENHLSVLAISNMEASSTL
AKCLYELNFTVQSKEQEKDSEILQ
Download sequence
Identical sequences K7FH61
ENSPSIP00000007371 ENSPSIP00000007371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]