SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009973 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009973
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-56
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 180-417
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000421
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-28
Family YWTD domain 0.0000452
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000785
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000315
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 10 Region: 132-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000624
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009973   Gene: ENSPSIG00000009050   Transcript: ENSPSIT00000010024
Sequence length 1461
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206742.1:637050:831257:-1 gene:ENSPSIG00000009050 transcript:ENSPSIT00000010024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWTDWGEVPKIERAGMDGSSRSVIINTDIYWPNGLTLDYEEWKLYWADAKLNFIHKSNL
DGTDRRAVVEGSLPHPFALTLFGDMLYWTDWNTHSILACNKSSGEDLHEIHSNIFSPMDI
HVFSQQRQPNATNPCGSNNGGCSHLCLMSPIQPSYRCACPTGVKLLENGKTCKEGATELL
LLARRTDLRRISLDTVDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SESQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYAENKIYWGDAKT
DKIEVMNADGSSRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKRSAEREIIIDQ
LPDLMGLKATNVHQIIGTNPCAKDNGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGKPMGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREILFFSGLSKPVALALDS
QLSKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKMD
MTGREGRMKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPICSDS
QFHCESGQCIDSTLRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKNKKCDHHLDC
SDSSDEQGCYTTEEPAPQANNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMAGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYAPSRRVMTAVAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPY
TERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences K7FPL3
ENSPSIP00000009973 ENSPSIP00000009973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]