SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011765 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011765
Domain Number 1 Region: 7-295
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.02e-58
Family ADP-ribosylglycohydrolase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011765   Gene: ENSPSIG00000010591   Transcript: ENSPSIT00000011822
Sequence length 296
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212172.1:4626976:4630868:-1 gene:ENSPSIG00000010591 transcript:ENSPSIT00000011822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCFSETLCYTDDTAMARCVARSLLAKGEFDEVDMARRFAEEHKKDPDRGYGMAVVKVFKK
LLSPKCSDVFEPAREQFNGKGSYGNGGAMRVAGISLIYPDVQDVKKFAKLSAELTHANSL
GYNGAILQALAVHLALQGELNGETFLEQLIGHMEDVEADDKSLADARAMGLQELPFSRRL
KKIKEFLELSTVPKSDVLFELGNGIAALQSVPTAIYSFLRSMKSDPDIPDHYNNLQRVII
YCISLGGDTDTIATMAGAIAGAYYGEEQVPPCWEQSCEAFQETQVLADSLHELYCQ
Download sequence
Identical sequences K7FUQ5
ENSPSIP00000011765 ENSPSIP00000011765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]