SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000014658 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000014658
Domain Number 1 Region: 598-701
Classification Level Classification E-value
Superfamily TAFH domain-like 5.75e-36
Family TAFH domain-like 0.00000491
Further Details:      
 
Domain Number 2 Region: 878-925
Classification Level Classification E-value
Superfamily Histone-fold 2.79e-17
Family TBP-associated factors, TAFs 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000014658   Gene: ENSPSIG00000013059   Transcript: ENSPSIT00000014727
Sequence length 1091
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209542.1:2241382:2311831:-1 gene:ENSPSIG00000013059 transcript:ENSPSIT00000014727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFLNTEVDEKVVSDLVGSLESQLAASGHHHQHHKAQEPLRTAGGLLGNHV
VSSSSSSSSPSPSPGFPPFSLSPPPCCCGKSWSARGGINHIGEIPPHTPGPLVYGAPSLP
PSLLLKCKALDGATTTSTTTAAAAGGGGSEAAAAPGTLSQGKSVVISTMATALSTRNGKI
GTTTVQTLNGSNVVMNSHHSAAAPTVAPLVNNGPGSVGKGNTVNAVLPSASNTVIQTSFL
STAVSSTSSPSPTVISSQPSPSIVGAGPTVALVRPPIHTAGPTVAAAAAATQNGSNTVIN
SAISVGVGSFPAVAAVTVGSGVSLQTPLVNSQPGSSVPAAPTTQVIKSESPKTIVHAVSQ
QQTLVASGQPSTTGGNMIIGQTMQAGLSNVAPNPGGIPPAAPGTPTGMAKGTTSTVAQSL
PRTPTATTSGIRATLTPTVLAPRLPQAPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQA
LAQMQAHAQSQPQNTMTPRPATPTSAPPVQISTVPAPGTPIIARQVTPTTIIKQVSQAQT
TVQPTTTLQRPPVVQPQIVLGGTAQTTALGTATAVQSGTPQRTVQGATATSTAATETMEN
VKKCKNFLSTLIKLASSGKQSSETTANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPY
LVPFLKRSLPALRQLTPDSAAFIQQSQQQQPTTQATTALTAVMLSSSVQRTAGKATATVT
STLQQPVISLTQPTQVGVGKQGQPTPLVIQQSQKAGALIRPPQVTLTQTPMVALRQPHNR
IMLTTPQQIQLNQLQTVPVVKPTVLPGNKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDI
NDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLPASLQRRILEIGKKHGITEI
HPDVVSYVSHATQQRLQNLVEKVSETAQQKNISYKDDERYEQASDVRAQLKFFEQLDQIE
KQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGP
RKKRKVDSPGSGSGTEGSSTSTAVPGSSGVGTTRQFTRQRITRVNLRDLIFCLENERETS
HSLLLYKAFLK
Download sequence
Identical sequences K7G2Z7
ENSPSIP00000014658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]