SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015522 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015522
Domain Number 1 Region: 518-754
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-55
Family DBL homology domain (DH-domain) 0.0000323
Further Details:      
 
Domain Number 2 Region: 751-880
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-37
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 335-389
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000082
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015522   Gene: ENSPSIG00000013632   Transcript: ENSPSIT00000015595
Sequence length 1369
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209116.1:4874871:4942764:-1 gene:ENSPSIG00000013632 transcript:ENSPSIT00000015595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDSDSPFNYSWPSLPKMRIRRRGTKQELRHSALDVLKKSPNPPAFFAAATHTAMLNGS
DEVYANCMVVDQGRDLDVNYINVDSITTEISTDHTCSTLTPNSSSSVSLKKSSQYVYAEN
EDNQMAMNNIDNIGSQLFTSPSNVYAAGSYLPLKSRGFNTERSQLYADLKKRSSSLDDLE
VDSGSEGISDRSHIRYPSLNSSVTLASSRDELDSSETSTDLDYSIHRMDSNNLLSKESLL
SGIRSRSYSCSSPKVLLGKSRFSRDFTVCDSNEEQRAYSLPEQSREKRIKEEEWDKYIIP
TKSESEKYKVSRTFSFLMNRMTSTRNKCKTKNKEAKDKLNRHQFITGNFSGNILCMACDK
ALLGKESLQCSYCNVIVHKNCKDCAPACTKKFQERYHVKTGSQAVLTNSSFRDLPQPIFS
SIHPSSSMPTGLSAVKKEVSQQPHALSRSVPCASFERRSMPSADQDTDSSSWRANSQPEM
LLQSIGTLPSMDSFVMEDDVDASLWTDLSTEAQEFEAESWSLVVDPAFCSKQEKDVIKRQ
DVIFELMQTEVHHIHTLFIMSEIFRKGMKEELQLDHSTVDRIFPCLDELLEIHRQFFCTL
KERRQESCEGGNERNFLINRIGDILVQQFSEESANKMKKIYGEFCSHQKEAVNIFKELQQ
NKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYSKEGTEEHKDLCSA
LCLIKDMIAAVDLKVNDYEKSQKLLEILNKIENKTFTKLKNGHVFRKQDLKKKERTLLHE
GLVYWKTATGRFKDSLALLLTDVLLFLQEKDQKYIFATVDQKPSVISLQKLIVREVANEE
RGMFLISASSAGPEMYEIHTNSKEERNTWMRQIQDAVESCPEEEGKISESDEDRQIAEAK
AAKIQKYQESLSNQDQQICSYLEDKLHIYAELGDMSGFEDVHVEPHLLIKPDSGEMPQAS
SLLAAALKEAESLHVAVTSSQANDTNRSSEESPGEPSLRLSPSTNEIVDSSTDSTEIKGD
EESFDFNPRICHAVNEVADSVLEEKVEHINFSGSTSTEVVQAIQNLTRLLYSIQAAVTIQ
DSHVEIHKTLLQEHERTSCGHSSRGNLLLDQEKYRNLEKQREELANIQKLQQQFHQEQQR
WARECDQQQREQEIRESQLQERERDCMCQEENLHRNQGELEHQLQEFQQDLERLKEGQRM
VEIERDKVKMQQKILWHWQHSRQSSLPATLPSSVSNEIMGRNQMESFCGENSFFINEALV
QMSLNSLNRSNPTLVYQDGVYGINTASSEISRTSENPPAVTHELWKSTAPCHQVSSCKSN
KDSCNNDLTLSQIQCPRTHSLNPGCIQVQPLVEVRFFLIHKYCMYIVVV
Download sequence
Identical sequences K7G5G1
ENSPSIP00000015522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]