SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016958 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016958
Domain Number 1 Region: 1871-2107
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-58
Family DBL homology domain (DH-domain) 0.0000222
Further Details:      
 
Domain Number 2 Region: 2106-2224
Classification Level Classification E-value
Superfamily PH domain-like 8e-23
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 1681-1744
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000012
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000016958
Domain Number - Region: 164-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000512
Family Ankyrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016958   Gene: ENSPSIG00000015102   Transcript: ENSPSIT00000017036
Sequence length 2319
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205157.1:2054104:2356536:1 gene:ENSPSIG00000015102 transcript:ENSPSIT00000017036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLHVWVMKLIPQQAPLYGDSIITVQLPEDVLEDDVTFYLVFTGSTVQHCTSTRKINPGT
LETIAPGHDCCETVKVALCASKEGLPALVLGEESFQFIQDEAYDAAQFLATCAGNQQALN
FTRFLDRSRLPSGDVDFLDEKVALAFRHLKLPAEWNVLGTDQTLNESSPRETLMHFAVRL
GLLRLTWFLLQQPGGRGALCIHNNEGATPVSLALERGYQKLYQLLTEEEAGEPDSWSTLS
HTVHSGDYCVKHHRGLNVYTLTTEAKEEAKASMEHDIEQLQKYIASHQHGNATEQPEPEL
STSEDNCNTGTELKGYPAAAAPPSEEMPTEESTSALVNFDAKQLSAPTCHKESQCDSGND
TSDDLLSLTSTKNPGFSCERQNSAMLRKKEEEGPAAIVDSGTVSDKKDGRLSSNAVVNGA
ASLSCCGNTSEETGMTSTGVILNQASLCCRDNTQQEVRIIEEHTTQSTVAAAETAGKAPT
PWEGVDVAMGQTECKNCTGMVDASSVQQHEENGGDETRGSKTTCLKEPPPVSGKLIHAVV
PLLGDFGDTVCDGEECEGAQGIQAQDSVSTHVNSDAVPVGCGATSDSKRNGADSNSEISK
MSLSKDLVQEEPIVKERQNVIANTEEELLVTQIKVSENALKQDPVGLEVNNNSKSGKLGV
ENVNGDIGLNELGLSDNMPNDSNAEMKNKPLDRPGPSDVESMSCPESSKTVALSVESEGD
SQALKRMPQETETMDGGSIDSAEGGLGSAGNCHAENKAVLKGEEMCDSLKPDTASASKCE
SGPHLPLDKDLSSAEKVPLQNQLVISESISEQEGVDKQIKSFSSSLFKGNVQQEEAIGQE
RDAAVAPPGQVVSVHSNDPVFPSCAMGTECVQDNLMDTPSANHNKEPKQNQEVAAATAAE
RAVLAEQDNSVHGKVTAETSLPLDSEEKDGQSPSQTDEENKAESSQELRESGTLGKEKGL
SEELAAVVKSSVCSQGEETAVNDSNAAIGQKEEISCQEADDNAAVDAEEGIVPGSESEYK
LLHTKNEPSPNAVLNQEHDLSEGIEGDTLQSRALDLKEVFAMEAPSVPFEPLGVAVTSTV
TDDREKEEEVNNVLSRASLQPIAEEPPCDSDSSTDTICLISEREAGSEVKETQQEVLDLS
SKDPEEQSNPMLEACFSQSVLCNINAATEPSEDVEAKSLIPEADCLQLDNVANSPVAFVS
MLETPSVPESAVEKLESVPVGVLPTSSPEAGVVTGAILNGEMDLSLQFELMRNGDASPEA
LGSEPITEKLEMKTEDEVDFLKDPSAHAVSEETINRESWCSIEPCSDPSLLEPTQAHESR
ECENFLEDGLSGDCASSQSVLKGETGSESEFFSLPGDGMDDIIFGKPEEEQSTCDITSSS
SSADDTMSLERNSSLGSDISLPQALNFNRPKERHTLDGSCINMAAGGGQESELGGSCEME
EEMDSITEVPPHSSVLRNSMRPLSPFRRHSWGPGKNAANEAEMNHRSSMRVLGDGIRKPP
IHRRSYSLEGLAGDSNDNKKPSSNLETSSLSCKDLRPSPLASDDRGSLVSLTEEEVESEQ
GESRGFDRQIRQRSQPHGFSFCASPTSSPLTKSISLMTIIQPGLDSTRLFNSTSSSLSQS
VSEESGNVLPPSPSRKDLEGKSGTKVSRTFSYLRNKMSSSKKSKEKEKDKEKTKEKDKDS
KEKEKDKKMLNGHLFSPTPTVGPISCYHCMKPFNKDSHLCANCNAIVHKGCKESLASCAK
VKMKQQKGMLQAHDTSSLPTVIMRSKTSQPKERPRSAILAPDESTITSVLNHRRSQQSTT
LSKSVSIQNIAGVVDENIIHTWKFLSQSTDSLHKISRVNESTESLTDEGADMNEGQLMGD
FEMDSKQLEAESWSQVVDSKFLQQQKENVVKRQDVLYELMQTEMHHVRTLKIMSDVYSRG
MMQELQFEQQMVEKVFPCLDDLLNIHSQFYQRILERKKESLVNKSEKNFVIRRIGDILVN
QFSGENGERMKKTYGKFCGHHNEAVNYFKDLQSKEKRFQAFIKKKMSSAVVRRLGIPECI
LLVTQRITKYPVLLQRILQYTKENEVEHQDLTQSLNLVKDVIAAVNSKVSNYEKKTRLSE
IYTRTDSKSIMRMKSGQMFAREDLRRRKLIRDGPVSLKNTAGRLKEVLAVLLSDTLVFLQ
EKDQKYVFASLDQRSTVISLKKLIVREVAHEEKGLFLITTVVKDPEMVEIERNSWIQIIQ
DTINTMDKDEDEGIPSESELEKRVLDTKARELKEQLQQKDQQILALLEEKEKIFRDMTDC
SMQEDSSVSRVLFRSTNELFSFLRVALFSLLNVCSSVHP
Download sequence
Identical sequences K7G9J7
ENSPSIP00000016958 ENSPSIP00000016958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]