SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019281 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019281
Domain Number 1 Region: 625-1052
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.37e-102
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000101
Further Details:      
 
Domain Number 2 Region: 26-283
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.32e-78
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000143
Further Details:      
 
Domain Number 3 Region: 289-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 5.49e-74
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000332
Further Details:      
 
Domain Number 4 Region: 1369-1539
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.89e-55
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019281   Gene: ENSPSIG00000017070   Transcript: ENSPSIT00000019371
Sequence length 1845
Comment pep:novel scaffold:PelSin_1.0:JH208030.1:2225516:2253719:1 gene:ENSPSIG00000017070 transcript:ENSPSIT00000019371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGIILALVFTLVGSEKYDPEPNFGSKTYVYNYEGLTMNGLPEPGLARAGLRLSCKVEIS
GLSEKVFLLKIRSPQLEEYNGIWPRDPFLRAPKVTQLFAPYLTKPWKFEYSKGRVGSLYA
PEDVPETIVNIVRGILNLLQISLKKSQNAYGLQEAGIGGVCFTRYAVQEDKRNNGIFISK
TKDLDNCQDKVVKNIGMTFIRPCPACPLKEKIVKGTAAFSYKLKYAEAGALITEARSQQI
YQVSPFNEPGGVAVTDARQELSFVEVKNEHVSPPEIHLQNRGSGTRFQFPPVLYQMPIQL
VKTKNPEQRIVEILQQTIQENQQELHADASYKLLELIQLCRVAKLDTLNSVFKQFSAKPH
HRLWLLSGITMAGTTDSLTFLKLKIHSEDLSYIESLMTVAAALHLTKADSHTIQVAAELL
VSSRLERIPMLRQIAYLAYASMISKHCSQSPSCPSEALQPIYDLAAEAASKGNEDDIALA
LKAMGNAEDPGSIKRIQKFLPIFSSGASVFPLRIHIEAVMALRQIGLKDPRKVQDILLQI
FADHSLSPEIRMLACAVIFETDPPLPVVTTIASVILKGTNMQVASFTYSYMKAMSRIRSP
RFYNISAACNIAIKLMSPRLERLSYRYSKAVLPLGAYYSAYQIGAIERIFLINSPKTMFP
SLLISNVIVNYAGAIAGSLEVGVHAEGLTDIIRKQNIPFAEYSTYRKIKEIGKTLLGWKV
LPSENPVFSAYIKAFGKELAFANVDKDLIQQLVKLATGPADRHTWLRKVINQIQSGIAGR
WIQPLYAAEFRHIVPNIVGLPLEYSLYTTALAHATGRVDAKLSPPLSGDFRPSELLESSL
QLRADVSPSIYSHTVVMMGINTEFVQSAIEINIKLHAQVPLKFDAKIDLKEKSFKVTTTP
CQEETVLAMGRHKAFAVSRNIGEPGAVKRIPVLPEDARSNILTEHFKSSERTSREGAVTQ
RVASDILPKKYAYSGEQELRHSAGRKVTTQAICVKLPRFGCQVCFYRKARDASVLKNTLF
HRLIGEHEAQLILKPASADAAIDKIQLEIQAGYRAASKIIQVVSLDSEEEEDSSPDDEVR
TKLKKILRIESVFKIGNRTQQHKKQSVKKEKTQMTELRTQPSTKYPPSSSSSSSDTSSSS
SSSSSSSSSPAPAGKKVKKQSPKDKTLQSRKRDGASPTRFRPQSYCGARTNLPKSDIAEL
LGALAHAFTIQQDYPSISPAGPEKCALHSSPTKASQGTTKGRRSSKSSSSSSSSSSPSPA
PSSSSSSSSSSPSLSSSSSSSSSSSSSEATSRAGSQVSFLIFKKCCMQCVGMAALPWICS
YCPPHGKREVAMQELPAEAASSFQHSESQVCLLLFHLGSKPKFLGDSTSPTLAVILRALR
NNKNLAGFQLVLYTDLYSTKPRIQAFVSNITGSSKWKICADASIVNAHKAATYLKWGRDC
QDYKIATEVVTGRFADHPAIQVKLEWPKVPSRFKSSLNWFYSFVPGIAYILGYSEIEHKN
PSQQAKMIVSLTSSRTFDFVAKLPERTIFSRALRLPISLPVGPPVPESAVQSPVWNFFSE
APSAVMEHLKARCTVSQDKITTFNEVKFNYSMPTNCYHILAQDCSPELKFLVMMKNAEES
ADLKAINVKLGHHEIDMYPENGLLSLMVNGVETPVENITLFSLILLDASLVINSEKKGLS
LLAPDYGIDKLYFDGRSLKVQVAFWMAGKTCGICGKYDAEKEQEFQMPSGSVAKDAVSFA
QSWILSEKPCAGACKLQRSLVKLERTIQLEGQESKCYSVEPVMRCIKGCSATETTPVSVG
FHCLPADSAASLVEGQMKLDQKSEDTRETIDAHTACSCEELQCIE
Download sequence
Identical sequences K7GG70
ENSPSIP00000019281 ENSPSIP00000019281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]