SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019404 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019404
Domain Number 1 Region: 289-621
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 5.23e-77
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000221
Further Details:      
 
Domain Number 2 Region: 44-288
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-70
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000291
Further Details:      
 
Domain Number 3 Region: 624-743
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-27
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019404   Gene: ENSPSIG00000017211   Transcript: ENSPSIT00000019495
Sequence length 743
Comment pep:novel scaffold:PelSin_1.0:JH208030.1:2267495:2283668:1 gene:ENSPSIG00000017211 transcript:ENSPSIT00000019495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLILALVFTFVGSQKYDIENLVLGTERPTCTAMKASFCMVCKTLARTGLKLTCKVEIS
GLSNNYHMLKIRSPQLEEYNGIWPTDPVIRSSKLIQTIASCFTQFFKFEYNRGQFGNIYA
PKDTPVTCVNLVRGILNMLQITVKKSQNAYNLQEAGIEGVCHTSYLIQEDRKTNQVTVSK
TKDLNNCQDKVAKNIGMAYIRPCATCPLKEKIIKGTAAFTYKMKYTDAGALITEAVSQQV
YQISPFSEPAGVAVIEAKQELTLNDIKSNQVSTSEIELQNYGSLRYHFSRELLQMPIHLI
KMKNPESQIVEILQKLIQHNEQVYNREAPTKFLELIQLCRVATPENLKSLWKQVADKPQY
RRWLLSAICAAGTTETFMFLKQKIHNGDFSYMESAMTIALAFHLSKADDDSLQAVADLMT
SIQIQRAPMLRKLAYLAYGSMINRYCAVAPSCPKEILQPLHDLAAEAISKNSEDDMALAL
KAMGNAGEPACIKRILKFLPIFSPAAKAFPVTIYIDAVLALRKIARKDPAKVQEILLQIF
VDQSLDPTVRMMTCVVIFETKPALSLITSMANALLKESSLQVASFTYSHMKALAINRIPQ
LYNVSAACNIAIKLLSPRLDRMNYRYSKVIHIGGYYPDYRVGAIGRIYLMNSPRSMVPSA
IIMKLRGYYANTATDFVEVALQSQGLSDLVRKQNVLFAEYDTYKKLKVLEKTLLGWKELP
PENPLISAYVKAFGHELAFADIN
Download sequence
Identical sequences K7GGJ3
ENSPSIP00000019404 ENSPSIP00000019404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]