SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000001844 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000001844
Domain Number 1 Region: 19-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-31
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 2 Region: 210-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000963
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000001844   Gene: ENSPSIG00000001851   Transcript: ENSPSIT00000001851
Sequence length 251
Comment pep:novel scaffold:PelSin_1.0:JH208533.1:2488727:2489482:-1 gene:ENSPSIG00000001851 transcript:ENSPSIT00000001851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMLLKRGGCLLLWMALLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFNMKTR
SSSGLVLYFDDEGFCDFLELILTQGGRLQLSFSIFCAEPATLLTDTAVNDNLWHTVVIRR
HFKNTTLLIDQTEAKWVEVKSKRRDMTVFSGLFLGGLPPELRSATLKLTLSSVKDREPFK
GWITDVRVNYTQASPVESQEVRLDDEQSRLCASDDVCLNGGICSVLNDQAVCDCSQTGFR
GKDCSEGKTSV
Download sequence
Identical sequences K7F1D4
ENSPSIP00000001844 ENSPSIP00000001844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]