SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009436 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPSIP00000009436
Domain Number - Region: 59-94
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.012
Family Recombination protein RecR 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009436   Gene: ENSPSIG00000008595   Transcript: ENSPSIT00000009483
Sequence length 178
Comment pep:novel scaffold:PelSin_1.0:JH209026.1:10767:14914:-1 gene:ENSPSIG00000008595 transcript:ENSPSIT00000009483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCVPLPSADKNPALEIRYRHKKSKDKEREGERDRAEKDELRKKAQELALDQSRGSKFSP
PQQQIKRSARMCGECEACRRTEDCGQCDFCRDMKKFGGPNKIRQKCRLRQCQVRARESYK
YFPASMLRGRDEDLQMLKEQLESSATPEPLSDDDLPIDPDLYQEFCAGAFDDQNLVRT
Download sequence
Identical sequences K7FN26
ENSPSIP00000009436 ENSPSIP00000009436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]