SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018390 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018390
Domain Number 1 Region: 695-874
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 26-56,134-263
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-29
Family Phosphotyrosine-binding domain (PTB) 0.0047
Further Details:      
 
Domain Number 3 Region: 849-972
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.15e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000018390
Domain Number - Region: 258-319
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0353
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018390   Gene: ENSPSIG00000016293   Transcript: ENSPSIT00000018476
Sequence length 1102
Comment pep:novel scaffold:PelSin_1.0:JH207290.1:499548:570640:1 gene:ENSPSIG00000016293 transcript:ENSPSIT00000018476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPDVISSIRQVSKAALKEDAKPGKDSEDAFYNSQKFEVLYCGKVTVAHKKAPSTLIDDC
IEKFSLHERQRLKLLSEQRSTDSSSDLTLYEGDVPASPSDSPFEEVEGSNAAIGIFTIGG
QTNLAGARVSFPEXSRCSSLTAVMQKRVHDTSLKTQPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIQHVDHFGFICRESVETGINQYVCYVF
QCASESLVDEIMLTLKQAFSTAAALQNAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKL
VIQRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEAPLN
ISNNAIPENTASSGRFKLDILKNKAKKSLTSSLENIFSRGASRMRGRLGSMDSFERCSSL
ASDKDCSPGDSPPATPPASPVSSVWQPFPEEDSDSPQFRRRAHTFSHPPSSSKRRITFQD
GRSQSVKSPLLRQNSVEQSSPVSTARQRFHSESGLPSSFSAPSFLKSFYQNSGRLLQQSE
NDLSKSLATENTDGEGRRRTSSVCSNESLNASGATVTPRRISWRQRIFLRVASPMNKSSS
AMQHQDGFEGNELLPLSPLAPALEEDPLSLILQNKDAPDNXQSLWRKAIHQQILLLRMEK
ENQKLEASRDELQSRKIKLDYIEVGTCQKDVINIWDKKLLNFRAKIRCDLEDIHITLKEG
VPKSRRGEIWQFLAVQHRVRHRLPSKQQPPNISYKELLKQLTAQQHAILVDLGRTFPTHP
YFSTQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDL
GFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAAPWFLTLFASQFPL
GFVARVFVLDIIFLQGTEVIFKVALSLLSSQESLVMECESFENIVDFLKGTIPDMSSLQM
EKIITQVFEMDISKQLHAYEVEYHVLQDELQEGLNPCDDSEPLEKLERANSQLKRQNMDL
LEKLQIAHAKIQSLESSLENILSRENEMRSLIQSLQQEKMVYQKTVEQISKYLPAEALSD
CELLLKEVNFNPNNKTKQGNKP
Download sequence
Identical sequences K7GDM9
ENSPSIP00000018390 ENSPSIP00000018390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]