SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005986 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005986
Domain Number 1 Region: 316-597
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-77
Family Kelch motif 0.0000926
Further Details:      
 
Domain Number 2 Region: 8-62,119-175
Classification Level Classification E-value
Superfamily POZ domain 7.85e-27
Family BTB/POZ domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005986   Gene: ENSPSIG00000005542   Transcript: ENSPSIT00000006021
Sequence length 615
Comment pep:novel scaffold:PelSin_1.0:JH206124.1:1051241:1144738:-1 gene:ENSPSIG00000005542 transcript:ENSPSIT00000006021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRCGDRTSTFNPSHSNNLLHGLNLLWRRQLFCSVTLVAQGQQFHCHKAVLASCSQYFRS
LFSSTGGGGHPQPLALGPSAQDGLGLGAPPKEQQQEEPGTPSSSPEDKLLASPRAINNLV
LQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLNDQISVQNY
KQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALFQMSVLWL
EHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMNYHLMPFR
QHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMPYNSAHHC
VVELENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYACRLDKNL
YVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGGVHNGEYVP
WLYCYDPVMDVWARKQDMNTKRAIHALAVMNDRLYAIGGNHLKGFSHLDVMLVECYDPKG
DQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYSPEKGTWTELEGDV
AEPLAEIFLMWILTF
Download sequence
Identical sequences K7FD76
ENSPSIP00000005986 ENSPSIP00000005986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]