SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009421 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009421
Domain Number 1 Region: 580-807
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-56
Family Kelch motif 0.00018
Further Details:      
 
Domain Number 2 Region: 305-431
Classification Level Classification E-value
Superfamily POZ domain 5.34e-27
Family BTB/POZ domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009421   Gene: ENSPSIG00000008534   Transcript: ENSPSIT00000009468
Sequence length 814
Comment pep:novel scaffold:PelSin_1.0:JH207517.1:1643025:2149137:1 gene:ENSPSIG00000008534 transcript:ENSPSIT00000009468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHHSRFERDYRTGWDRREWSSNGNHVNSSNCNSTASSNCNNRPGLLPLPIVPSRLPTP
ATAACTTVNSDVITSLVANSSAASTTKTPCISKTENQPQGLATSVRWGQTPINQSTPWDT
DEPPSKQMRENENPGTAPWVTTVPAGSQPTLITHSYGMTQPPTFSPAVNVQAPVIGVTPS
LPPHVTPQLPLMPAHYQLQQQPSQPLSNMVVNLQNQPLYTNSQPIMSSMTGVGQVTHPGH
TAVGNGHMTCPILPPPPPALPSAALPNSVPATNGQAAAQLPPNQTGNQDNTNGVQMLRTI
GVGKYEFTDPWHPKEMLKELNQQRRAKEFTDLKIIVEGKEFEVHQNVLASCSLYFKDLIK
RSPRDSSRGGEKLELAMSNLTADVLELLLEFVYTGSLIIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGILAMAEAMQCSELYNMAKAYALQIFPDVANQEEILNISKDDF
ISYMSNDSLNTKAEELVYETVIKWIKKDAALRAEYAAELLAVVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGGMESGVTLSDVWCYMSLLD
NWNLVSRMTVPRCRHNSLVYDGKIYTIGGVGVAGNVDHVERYDTITNQWETIAPLPKAVH
SAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNAWSFIESPMIDNKYAPAVTLNGFIF
ILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNME
AYDHKTNTWTLLPNMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences K7FN11
ENSPSIP00000009421 ENSPSIP00000009421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]