SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010507 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010507
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-71
Family Kelch motif 0.0000444
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 5.1e-35
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010507   Gene: ENSPSIG00000009519   Transcript: ENSPSIT00000010560
Sequence length 600
Comment pep:novel scaffold:PelSin_1.0:JH209303.1:9037250:9069549:-1 gene:ENSPSIG00000009519 transcript:ENSPSIT00000010560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREDSGVRDSPATKRKVFEMDPKSLSGHEFFDFSSGSSHAENILQIFNEFR
DSRLFTDVIICVEGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGIFAEAMDCF
LQYVYTGKVKITTENVQYIFETSSLFQISVLRDACAKFLEEQLDACNCLGIQRFADTHSL
KTLFTKCKNFALQTFEDVSQHEEFLELGKDELIDYICSDELVISKEEMVFEAVMRWVYRS
VDLRRPMLQELLTHVRLPLLHPNYFVQTVEVDQLIQTSPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVIVGGCERVGGFNLPYNECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQSR
LSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPDTN
SWLLRATIPIAKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMS
VCNGKIYILGGRRENGEATDTILCYDPATGIITGVAAMPRPVSYHGCVTIHRYNEKSFKL
Download sequence
Identical sequences K7FR68
ENSPSIP00000010507 ENSPSIP00000010528 ENSPSIP00000010507 XP_006125259.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]