SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010920 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010920
Domain Number 1 Region: 315-599
Classification Level Classification E-value
Superfamily Kelch motif 3.79e-59
Family Kelch motif 0.0000841
Further Details:      
 
Domain Number 2 Region: 48-163
Classification Level Classification E-value
Superfamily POZ domain 3.45e-32
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010920   Gene: ENSPSIG00000009845   Transcript: ENSPSIT00000010976
Sequence length 617
Comment pep:novel scaffold:PelSin_1.0:JH209303.1:9101639:9141398:1 gene:ENSPSIG00000009845 transcript:ENSPSIT00000010976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSGSNMGDTVEKSSEDPLVSLDNEYSRKMGDLVEISSGDKVKFDDTGLSMVLQNGLEN
LRLENSLTDVILCVDHMEFSCHRVVLAAASNYFRAMFCNDLKEKYEEKIIIQGVDAETMQ
MLLDYTYTSQVLITKQNVQKVLEAASLFQFLRMVDACASFLTEALQPENCVGILRLADTH
SLENLKQQVQSYIIQNFAQALNYEEFLEIPIDVLCNTLKSDDLYVTEEAQVFEIVMNWVR
YKESERFPRLPYVLENVRLPLLDPWYFVETVEADQLIRQCPDVFPLLQEARMYHLSGNEI
ISERTKPRMHEFQSEVFMIIGGCTKDEKFVAEVTCLDPLRRSRLEVAKLPITEQETESEN
KKWVEFACITLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMAVLGGKVY
VVGGFDGAQRINSVETYDPFHNCWSEAAPLMVNVSSFATASYKKKLYVIGGGPNGKLATD
KTQCYDPAVNTWSLKSPMPVEAKCINAASFRDHIYVVGGAMKALYSYSPLQDTWCLVTQF
THERASCGISPCNNKLFITGGRDEKNEVIATVLCWDPAIQKLTEECVLPRGVSHHGSVTL
RKSYTHIRRIVPGAVSV
Download sequence
Identical sequences K7FSB0
ENSPSIP00000010920 ENSPSIP00000010920 XP_006125261.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]