SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000013573 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000013573
Domain Number 1 Region: 338-631
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-77
Family Kelch motif 0.0000132
Further Details:      
 
Domain Number 2 Region: 67-187
Classification Level Classification E-value
Superfamily POZ domain 1.85e-32
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000013573   Gene: ENSPSIG00000012199   Transcript: ENSPSIT00000013637
Sequence length 653
Comment pep:novel scaffold:PelSin_1.0:JH212508.1:2181410:2293650:1 gene:ENSPSIG00000012199 transcript:ENSPSIT00000013637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWKETLGVTNLDGMDHSVLRGEMSAVLHDRSLVEEEDPHMKVSLGSSDMGVSAHLQSSK
TGTTRFFTSNTHSSVVLQGFDQLRIEGLLCDVTLVPGDGDEVFPVHRAMMASASDYFKAM
FTGGMKEQDLMCIKLHGVNKIGLKKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDF
CKVFLISGVSLENCVEVGRIANTYNLTEVDKYVNNFILKNFPALLSTGEFVKLPFERLAF
VLSSNSLKNCTELELFKAACRWLRYEEPRMEYAAKLMKNIRFPLMTPQDLINYVQTVDFM
RTDNTCVNLLLEASNYQMMPYMQPVMQSERTAIRSDNTHLVTLGGVLRQQLVVSKELRMY
DEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWM
QVASLNEKRTFFHLSALKGHLYAVGGRNAAGELATVECYNPRMNEWSYVAKMNEPHYGHA
GTVYGGLMYISGGITHDTFQKELMCFDPDTDKWTQKAPMTTVRGLHCMCTVGDKLYVIGG
NHFRGTSDYDDVLSCEYYSPTLDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCM
VEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEDNTGSPSRESPLSAP
Download sequence
Identical sequences K7FZW3
ENSPSIP00000013573 XP_006135384.1.96668 ENSPSIP00000013573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]