SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000014569 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000014569
Domain Number 1 Region: 1-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.27e-69
Family ADP-ribosylglycohydrolase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000014569   Gene: ENSPSIG00000013014   Transcript: ENSPSIT00000014637
Sequence length 361
Comment pep:novel scaffold:PelSin_1.0:JH224663.1:162758:197186:1 gene:ENSPSIG00000013014 transcript:ENSPSIT00000014637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFKAAILLAGVGDALGYRNFTRENSALGAKIQEELKEIGGLQNLVLSAEKWPVSDNTL
MHMATAEAVITDGQSPYLEDLYRELVKRYVDIIDRLPGRRPDPATIEGCSQLKPDNYLLA
WHTPFNEKGSGFGAATKAMCLGMKYWKPERLDTLIEVSIECGRMTHNHPTGFLGSFCTAL
FVSYAIQGKPLVQWGREMMKVVPMAEEYCKKTIRHMAEYQEHWFYFEAKWQFYLEEREIT
EENQNKPVFPDNYDAEEREKTYRRWSSEGRGGRRGHDAPMIAYDALLGCGGDWTELCNRA
MFHGGESAATGSIAGCLYGLLYGLNKVPKGLYQDLEHRERLEFLGETLYQRSTEENTMVY
M
Download sequence
Identical sequences K7G2Q8
ENSPSIP00000014569 ENSPSIP00000014569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]