SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017778 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017778
Domain Number 1 Region: 726-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-54
Family Ankyrin repeat 0.000036
Further Details:      
 
Domain Number 2 Region: 445-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.78e-48
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 221-409,440-521
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-45
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 4 Region: 48-157
Classification Level Classification E-value
Superfamily POZ domain 2.2e-21
Family BTB/POZ domain 0.0064
Further Details:      
 
Domain Number 5 Region: 1103-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.45e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017778   Gene: ENSPSIG00000015710   Transcript: ENSPSIT00000017859
Sequence length 1168
Comment pep:novel scaffold:PelSin_1.0:JH212623.1:4300809:4341164:1 gene:ENSPSIG00000015710 transcript:ENSPSIT00000017859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFAEDVAKLEKHLLLLRQEYVKLQKKLADTERRCTLLAAKSNKENDSDSFISRLLTIVAD
LYEQEQYSDLKIKVGDKRINAHKFVLAARSETWSLASLVSTEELDLSDADPEVTMAMLRW
IYTDELELREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCICFYQTAEELNAS
TLLNYCAEIIASHWDDLRKEDFSSMSAQLLYKMFKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNELDHNGDLALDLALSRKLESIATTLVNYKADVDMVDKRGWSLLHKAIQRG
DKFASNFLIKNGARVNAATLGDQETPLHLVASYSPKKHFPDVMSEMAQIAESLLQAGANP
NMQDCKGRTPLHASIVVRNDPVFSQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDPSV
NPFDDVPVVNGTSFDENSFAARLIQRGSNTDAPDTVTGNCLLQRAAGAGNEAAALFLATH
GAKVNHRNKWGETPLHTSCRHGLANLTAELLQQGANPNIQTEEAVPSRKDATSPTASDNV
YLQTPLHMAIAYNHPDVVSVILEQKANALHAPNNLQIIPDFSLKDSRDQTVLGLALWTGM
HTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQL
AIKNQLPLVVDAICTRGADMSVPDEKGNPPLWLALENHLEDIASTLVRHGCDATCWGPGP
SGCLQTLLHRAIDENSEPIACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAACWG
LEEVIQCLLEFGANVNAQDAEGRTPIHVAISNQHSVIIQLMISHPEIRLNMRDRQGMTPF
ACAMTYKNNKAAEAILKREPGAAEQVDNKGRNFLHIAVQNSDIESVLFLISVQANVNSRV
QDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLEN
GVDFAAVDENGNNALHLAVMHGRLNNIRILLTECNVDAEAFNLRGQSPMHILGHYGKDNA
AAICDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNIF
NYQVATKQLLFRLLDMLSKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHRCSTKE
IPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences K7GBW7
ENSPSIP00000017778 ENSPSIP00000017778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]