SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019420 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019420
Domain Number 1 Region: 318-596
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-84
Family Kelch motif 0.000000537
Further Details:      
 
Domain Number 2 Region: 46-163
Classification Level Classification E-value
Superfamily POZ domain 3.65e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019420   Gene: ENSPSIG00000017244   Transcript: ENSPSIT00000019511
Sequence length 646
Comment pep:novel scaffold:PelSin_1.0:JH224678.1:3802483:3827283:-1 gene:ENSPSIG00000017244 transcript:ENSPSIT00000019511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKPMRRCTSTRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINL
LRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAME
LLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTH
SCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVK
YSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQER
PLMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGV
SVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGG
QDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERY
NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAM
TSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIK
MTHCESHICINSDLGLQAVPGVWQRGGRLLLEQWKCHPCSGHERGK
Download sequence
Identical sequences K7GGK9
ENSPSIP00000019420 ENSPSIP00000019420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]