SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PYU1_T005473 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005473
Domain Number 1 Region: 307-392
Classification Level Classification E-value
Superfamily E set domains 0.0000013
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Weak hits

Sequence:  PYU1_T005473
Domain Number - Region: 46-131,158-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0011
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number - Region: 81-122
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00494
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005473
Sequence length 1827
Comment protein Name="PYU1_T005473" Note="Similar to SVEP1: Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (Homo sapiens)" AED:1 QI:0|0|0|0|1|1|2|0|1827
Sequence
MEDARTSVVSRGIRVYLDGAVGTGAVVPTWAPVGSFSGSTGSVAATLCFPGTYTPLKGTV
ACEVCPAGHTCPGYGTYIPSLCPKGYYRSLADSITCRSCPEGTWSSRTGVPDISLCEICP
PGRVCGSSAMSTLSSSLPCAAGYVCGEGTNRRSQFDHLCPGGQYCDSTTTIDAQFTNNTC
EKGYACQRGTKYQERNKNKCLDGKFCPLGTANMSSIYIQCPKDTWTGSGQDELLDCVIRA
VPICDKSPTKQYYPKFSYQFQGNEITFDSTVDSASRTGEVEVVQIVYPVNESASVPFWRN
DTVDTIRVCPSVGDVRGGTLLTVIGHNFQDTGRLVCSFQIRDYGHAFTAPAFFVNSTRVT
CRVPPFSGEVDGDTFAQEIDVRVSNYGVYFSTTAAIYTFVSNAALKTLGGSTKLAQCLVG
RSGEEGFRDDDKAWFALRGLSKAKLSFDFRHIPPDMVYDEHYKIAIFVKNSTCESQSCDS
RGVIKPSGTEIETWPCNLPLELPKWFLSTDVDKHDIVNITLLALEDVIFKVEIHIMYGLY
APTAPFFANSTTVRLKTPVRSNATQGIDADLRPLSRSISHEEALIPRDYTFLIVYFGGDS
DYTSSPLNLPPKYQAFERGRVLISHNVSNASADHIPLVVDAFEDVKPGAAYWVMPFGSTE
LTHQMALKYRETFHELYLDPTDPTETQYLFKFEKILLSYLPFFSNCMEYDSYIPIFDLFE
SDACNLPEMTSEQEAYGRNWWRRQFPPLPNQDDIRYVGPLDVGKEPTADICMMNLQCHYE
EELPTADVTPRWFEQSQDTVLFYLLREPTTMANYFRGGAYYDELDATQGSDYFIPVTVDN
SASGELEGDCSMLCFPRSVTLDVAYYQLDNNVKRIIKAQLILASYDRDATNTGYTFSVNL
HPLDYYQLVIQFAFEQEVYVLLFFVLGGAMTVGAFVFWALVRLTTFLESPPRFRFYAVFA
LIAPPPSVGVALASVPIFSVVCGFYLLLKGDLYYSAGRSSSGYWLLDNVVKHYLDDKIDP
DEVEATRKGRIGFCFLTLGLYLILLGAKIFLPKPIAISEKIIAEKQDDEARERSIWWPTQ
WKRANMILTSILLGLFLCLMLEFSFWSSFGDYMFYVIVLTEVVNSVVEGWIEGQLKEALL
MAPLVSALSLVGGLMTFGATDFGDFVMGNTLDFGMMLLMRVYADTAFEAIGEFNSMILGY
MFQKLKAGALILLALFRSFNRSTVVVPTAVEESDGAKKAAEKKKEEDTKKAAEKKKEGDA
KPEEEEAGATVEPIIDFYAGASMDRLALFYQPILILLMMYFRDELMLPIIYNIREKDMEI
YLWYSLIILFFQLVTEVFVLNVVELFQGWKLYDYLVYSRYRFLQREQRWKGLEPNLDECI
EENLRTLDQMCFSSQFFMMCTVHITGIVFFVVAIEIMARAEYNLFGDPAMPILLAFVLCS
ALFVRHLVMFLAVKFEVWKIKHENTAWLAPSDDDDEFGVPRWDELEKIKGASHEAYLMNQ
RITSETFRFKFLNYNRSWIVNQLPSILTPRTLRRARPYLLAQFAKILDSLNPQVSDDDEA
DDDGRPRFGPVILSASSRTIIRLWLARARRIQRLKAVVQPIIQQARKSECEMCLSRRQLQ
VELAIPIELLGDKFESQSLAEEFDVAGWKEFFTKHEKFKTLCLNCIVHLKTTTPESRGFG
GGNGFNGDDGNGAAWGNDPVRLNAASYALMQKWYRKAQDRVFGKNGGRRRNLVDVSDDEE
ETMARHFEWTKKPVALNAASTALARKWIMSARQSLRASGRSRTTLPENLTTIHPAITRGG
ATPIPKPAMKMGAAGGDAVKMSKMRRK
Download sequence
Identical sequences K3WKI1
PYU1_T005473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]